Overview

  • Product name

    Anti-LRCH1 antibody
  • Description

    Rabbit polyclonal to LRCH1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human LRCH1 aa 1-105.
    Sequence:

    MATPGSEPQPFVPALSVATLHPLHHPHHHHHHHQHHGGTGAPGGAGGGGG GSGGFNLPLNRGLERALEEAANSGGLNLSARKLKEFPRTAAPGHDLSDTV QADLS


    Database link: Q9Y2L9

  • Positive control

    • WB: HeLa and MCF7 cell lysate. IHC-P: Human kidney tissue. ICC/IF: MCF7 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab234875 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.
IHC-P 1/20 - 1/200.
WB 1/1000 - 1/5000. Predicted molecular weight: 81 kDa.

Target

  • Sequence similarities

    Contains 1 CH (calponin-homology) domain.
    Contains 9 LRR (leucine-rich) repeats.
  • Information by UniProt
  • Database links

  • Alternative names

    • Calponin homology domain-containing protein 1 antibody
    • CHDC1 antibody
    • KIAA1016 antibody
    • Leucine-rich repeat and calponin homology domain-containing protein 1 antibody
    • Lrch1 antibody
    • LRCH1_HUMAN antibody
    • Neuronal protein 81 antibody
    • NP81 antibody
    see all

Images

  • All lanes : Anti-LRCH1 antibody (ab234875) at 1/1000 dilution

    Lane 1 : HeLa (Human epithelial cell line from cervix adenocarcinoma) cell lysate
    Lane 2 : MCF7 (Human breast adenocarcinoma cell line) cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 81 kDa

  • Paraffin-embedded human kidney tissue stained for LRCH1 using ab234875 at 1/100 dilution in immunohistochemical analysis.

  • MCF7 (Human breast adenocarcinoma cell line) cells labeling LRCH1 using ab234875 at 1/100 dilution in ICC/IF. Secondary antibody used was an Alexa Fluor® 488-conjugated goat anti-rabbit IgG (H+L).

References

ab234875 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234875.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up