Overview

  • Product name

  • Description

    Rabbit polyclonal to LRG1/LRG
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Rat
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Rat LRG1/LRG aa 39-308. Expressed in E.coli. N-terminal tags.
    Sequence:

    LQSAEGSTVSCHGPTEFPSSLPADTVHLSVEFSNLTQLPAAALQGCPGLR ELHLSSNRLQALSPELLAPVPRLRALDLTRNALRSLPPGLFSTSANLSTL VLRENQLREVSAQWLQGLDALGHLDLAENQLSSLPSGLLASLGALHTLDL GYNLLESLPEGLLRGPRRLQRLHLEGNRLQRLEDSLLAPQPFLRVLFLND NQLVGVATGSFQGLQHLDMLDLSNNSLSSTPPGLWAFLGRPTRDMQDGFD ISHNPWICDKNLADLCRWLV


    Database link: Q91XL1

  • Positive control

    • WB: HepG2 cell lysate. Recombinant rat LRG1/LRG protein. IHC-P: Rat kidney tissue.
  • General notes

     This product was previously labelled as LRG1

     

Properties

Applications

Our Abpromise guarantee covers the use of ab231194 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Tissue specificity

    Plasma.
  • Sequence similarities

    Contains 8 LRR (leucine-rich) repeats.
    Contains 1 LRRCT domain.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • 1300008B03Rik antibody
    • 2310031E04Rik antibody
    • A2GL antibody
    • A2GL_HUMAN antibody
    • HMFT1766 antibody
    • Leucine rich alpha 2 glycoprotein antibody
    • Leucine-rich alpha-2-glycoprotein 1 antibody
    • Leucine-rich alpha-2-glycoprotein antibody
    • Leucine-rich alpha-2-glycoprotein precursor antibody
    • LRG antibody
    • LRG1 antibody
    see all

Images

  • DAB stained formalin-fixed paraffin-embedded rat kidney tissue stained for LRG1/LRG using ab231194 at 20 µg/mL for immunohistochemical analysis.

  • Anti-LRG1/LRG antibody (ab231194) at 2 µg/ml + HepG2 (Human liver hepatocellular carcinoma cell line) cell lysate
  • Anti-LRG1/LRG antibody (ab231194) at 2 µg/ml + Recombinant rat LRG1/LRG protein.

References

ab231194 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231194.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up