Overview

  • Product name

  • Description

    Rabbit polyclonal to LRP16
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human LRP16.
    Sequence:

    SFLKGLSDKQREEHYFCKDFVRLKKIPTWKEMAKGVAVKVEEPRYKKDKQ LNEKISLLRSDITKLEV

  • Positive control

    • Human colon tissue.
  • General notes

    Protein previously labeled as MACROD1.

Applications

Our Abpromise guarantee covers the use of ab122688 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Recommend PFA Fixation and Triton X-100 treatment

IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Plays a role in estrogen signaling. Binds to androgen receptor (AR) and amplifies the transactivation function of AR in response to androgen. May play an important role in carcinogenesis and/or progression of hormone-dependent cancers by feed-forward mechanism that activates ESR1 transactivation. Could be an ESR1 coactivator, providing a positive feedback regulatory loop for ESR1 signal transduction. Could be involved in invasive growth by down-regulating CDH1 in endometrial cancer cells. Enhances ESR1-mediated transcription activity.
  • Involvement in disease

    Note=A chromosomal aberration involving MACROD1 is found in acute leukemia. Translocation t(11;21)(q13;q22) that forms a RUNX1-MACROD1 fusion protein.
  • Sequence similarities

    Contains 1 Macro domain.
  • Information by UniProt
  • Database links

  • Alternative names

    • LRP16 antibody
    • MACD1_HUMAN antibody
    • MACRO domain containing 1 antibody
    • MACRO domain-containing protein 1 antibody
    • Macrod1 antibody
    • O-acetyl-ADP-ribose deacetylase MACROD1 antibody
    • Protein LRP16 antibody
    see all

Images

  • Immunofluorescent staining of Human cell line A-431 shows positivity in mitochondria. Recommended concentration of ab122688 1-4 µg/ml. Cells treated with PFA/Triton X-100.
  • ab122688, at 1/200 dilution, staining LRP16 in paraffin-embedded Human colon tissue by Immunohistochemistry.

References

This product has been referenced in:

  • Agnew T  et al. MacroD1 Is a Promiscuous ADP-Ribosyl Hydrolase Localized to Mitochondria. Front Microbiol 9:20 (2018). Read more (PubMed: 29410655) »
  • Ahmed S  et al. Loss of the Mono-ADP-ribosyltransferase, Tiparp, Increases Sensitivity to Dioxin-induced Steatohepatitis and Lethality. J Biol Chem 290:16824-40 (2015). Read more (PubMed: 25975270) »
See all 2 Publications for this product

Customer reviews and Q&As

Abreviews
Application
Western blot
Sample
Human Cell lysate - whole cell (Prostate)
Gel Running Conditions
Reduced Denaturing (10% Gel)
Loading amount
100 µg
Specification
Prostate
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 25°C

William Cao

Verified customer

Submitted Mar 15 2018

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up