Overview

  • Product name

    Anti-Lrp2 / Megalin antibody
    See all Lrp2 / Megalin primary antibodies
  • Description

    Rabbit polyclonal to Lrp2 / Megalin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Lrp2/ Megalin aa 202-332.
    Sequence:

    CDHDNDCQDGSDEHACNYPTCGGYQFTCPSGRCIYQNWVCDGEDDCKDNG DEDGCESGPHDVHKCSPREWSCPESGRCISIYKVCDGILDCPGREDENNT STGKYCSMTLCSALNCQYQCHETPYGGACFC


    Database link: P98164

  • Positive control

    • IHC-P: Human kidney and breast cancer tissues. ICC/IF: MCF7 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab236244 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/200 - 1/500.
IHC-P 1/500 - 1/1000.

Target

  • Function

    Acts together with cubilin to mediate HDL endocytosis (By similarity). May participate in regulation of parathyroid-hormone and para-thyroid-hormone-related protein release.
  • Tissue specificity

    Absorptive epithelia, including renal proximal tubules.
  • Involvement in disease

    Defects in LRP2 are the cause of Donnai-Barrow syndrome (DBS) [MIM:222448]; also known as faciooculoacousticorenal syndrome (FOAR syndrome). DBS is a rare autosomal recessive disorder characterized by major malformations including agenesis of the corpus callosum, congenital diaphragmatic hernia, facial dysmorphology, ocular anomalies, sensorineural hearing loss and developmental delay. The FOAR syndrome was first described as comprising facial anomalies, ocular anomalies, sensorineural hearing loss, and proteinuria. DBS and FOAR were first described as distinct disorders but the classic distinguishing features between the 2 disorders were presence of proteinuria and absence of diaphragmatic hernia and corpus callosum anomalies in FOAR. Early reports noted that the 2 disorders shared many phenotypic features and may be identical. Although there is variability in the expression of some features (e.g. agenesis of the corpus callosum and proteinuria), DBS and FOAR are now considered to represent the same entity.
  • Sequence similarities

    Belongs to the LDLR family.
    Contains 17 EGF-like domains.
    Contains 36 LDL-receptor class A domains.
    Contains 37 LDL-receptor class B repeats.
  • Cellular localization

    Membrane. Membrane > coated pit.
  • Information by UniProt
  • Database links

  • Alternative names

    • Calcium sensor protein antibody
    • DBS antibody
    • Glycoprotein 330 antibody
    • gp330 antibody
    • Heymann nephritis antigen homolog antibody
    • Low-density lipoprotein receptor-related protein 2 antibody
    • LRP-2 antibody
    • Lrp2 antibody
    • LRP2_HUMAN antibody
    • Megalin antibody
    see all

Images

  • Paraffin-embedded human kidney tissue stained for Lrp2 / Megalin using ab236244 at 1/600 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30min at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized tissue using an HRP conjugated SP system.

  • Paraffin-embedded human breast cancer tissue stained for Lrp2 / Megalin using ab236244 at 1/600 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30min at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized tissue using an HRP conjugated SP system.

  • 4% formaldehyde-fixed, 0.2% Triton X-100 permeabilized MCF7 (human breast adenocarcinoma cell line) cells stained for Lrp2 / Megalin (green) using ab236244 at 1/200 dilution in ICC/IF, followed by Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L). Counter-stained with DAPI.

References

ab236244 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236244.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up