Overview

  • Product name

  • Description

    Rabbit polyclonal to LRP4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human LRP4 aa 1757-1877.
    Sequence:

    PGMGNLTYSNPSYRTSTQEVKIEAIPKPAMYNQLCYKKEGGPDHNYTKEK IKIVEGICLLSGDDAEWDDLKQLRSSRGGLLRDHVCMKTDTVSIQASSGS LDDTETEQLLQEEQSECSSVH


    Database link: O75096

  • Positive control

    • IHC: Human pancreas tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224253 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Potential cell surface endocytic receptor, which binds and internalizes extracellular ligands for degradation by lysosomes. Involved in the negative regulation of the canonical Wnt signaling pathway, being able to antagonize the LRP6-mediated activation of this pathway.
  • Tissue specificity

    Expressed in several regions of the brain.
  • Involvement in disease

    Defects in LRP4 are the cause of Cenani-Lenz syndactyly syndrome (CLSS) [MIM:212780]. It is a congenital malformation syndrome defined as complete and complex syndactyly of the hands combined with malformations of the forearm bones and similar manifestations in the lower limbs.
  • Sequence similarities

    Belongs to the LDLR family.
    Contains 3 EGF-like domains.
    Contains 8 LDL-receptor class A domains.
    Contains 20 LDL-receptor class B repeats.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • KIAA0816 antibody
    • LDLR dan antibody
    • Low density lipoprotein receptor related protein 4 antibody
    • Low-density lipoprotein receptor-related protein 4 antibody
    • LRP-4 antibody
    • LRP10 antibody
    • Lrp4 antibody
    • LRP4_HUMAN antibody
    • MEGF7 antibody
    • Multiple epidermal growth factor like domains 7 antibody
    • Multiple epidermal growth factor-like domains 7 antibody
    see all

Images

  • Paraffin-embedded human pancreas tissue stained for LRP4 using ab224253 at 1/200 dilution in immunohistochemical analysis.

References

ab224253 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224253.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up