Overview

  • Product name

    Anti-LRP4 antibody [N207/27] - N-terminal
    See all LRP4 primary antibodies
  • Description

    Mouse monoclonal [N207/27] to LRP4 - N-terminal
  • Host species

    Mouse
  • Tested applications

    Suitable for: ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Rat, Human
    Predicted to work with: Mouse
  • Immunogen

    Fusion protein (His-tag) corresponding to Mouse LRP4 aa 26-350 (N terminal). Extracellular domain.
    Sequence:

    ACGRSHFTCAVSALGECTCIPAQWQCDGDNDCGDHSDEDGCTLPTCSPLD FHCDNGKCIRRSWVCDGDNDCEDDSDEQDCPPRECEEDEFPCQNGYCIRS LWHCDGDNDCGDNSDEQCDMRKCSDKEFRCSDGSCIAEHWYCDGDTDCKD GSDEESCPSAVPSPPCNLEEFQCAYGRCILDIYHCDGDDDCGDWSDESDC SSHQPCRSGEFMCDSGLCINSGWRCDGDADCDDQSDERNCTTSMCTAEQF RCRSGRCVRLSWRCDGEDDCADNSDEENCENTGSPQCASDQFLCWNGRCI GQRKLCNGINDCGDSSDESPQQNCR


    Database link: Q8VI56

  • Epitope

    extracellular domain
  • Positive control

    • WB: Rat brain membrane lysate. ICC/IF: SK-N-BE cells.
  • General notes

    The clone number has been updated from S207-27 to N207/27, both clone numbers name the same antibody clone.

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.09% Sodium azide
    Constituents: 49% PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Clonality

    Monoclonal
  • Clone number

    N207/27
  • Isotype

    IgG2a
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab174637 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/100.
WB 1/1000. Predicted molecular weight: 212 kDa.

Target

  • Function

    Potential cell surface endocytic receptor, which binds and internalizes extracellular ligands for degradation by lysosomes. Involved in the negative regulation of the canonical Wnt signaling pathway, being able to antagonize the LRP6-mediated activation of this pathway.
  • Tissue specificity

    Expressed in several regions of the brain.
  • Involvement in disease

    Defects in LRP4 are the cause of Cenani-Lenz syndactyly syndrome (CLSS) [MIM:212780]. It is a congenital malformation syndrome defined as complete and complex syndactyly of the hands combined with malformations of the forearm bones and similar manifestations in the lower limbs.
  • Sequence similarities

    Belongs to the LDLR family.
    Contains 3 EGF-like domains.
    Contains 8 LDL-receptor class A domains.
    Contains 20 LDL-receptor class B repeats.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • KIAA0816 antibody
    • LDLR dan antibody
    • Low density lipoprotein receptor related protein 4 antibody
    • Low-density lipoprotein receptor-related protein 4 antibody
    • LRP-4 antibody
    • LRP10 antibody
    • Lrp4 antibody
    • LRP4_HUMAN antibody
    • MEGF7 antibody
    • Multiple epidermal growth factor like domains 7 antibody
    • Multiple epidermal growth factor-like domains 7 antibody
    see all

Images

  • 4% paraformaldehyde-fixed SK-N-BE (human neuroblastoma cell line) cells stained for LRP4 (green) using ab174637 at 1/100 dilution in ICC/IF. Secondary antibody is Goat Anti-Mouse ATTO 488 at 1:100. Actin is detected with Phalloidin Texas Red F-Actin stain (red). The nuclear counterstain is DAPI (blue).

  • Lane 1 : Anti-LRP4 antibody [N207/27] - N-terminal (ab174637) at 1/500 dilution
    Lane 2 : Anti-LRP4 antibody [N207/27] - N-terminal (ab174637) at 1/1000 dilution
    Lane 3 : Anti-LRP4 antibody [N207/27] - N-terminal (ab174637) at 1/2000 dilution

    All lanes : Rat brain membrane lysate

    Predicted band size: 212 kDa

References

This product has been referenced in:

  • Smuder AJ  et al. Cervical spinal cord injury exacerbates ventilator-induced diaphragm dysfunction. J Appl Physiol (1985) 120:166-77 (2016). Read more (PubMed: 26472866) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab174637.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up