Anti-PPIL5/lrr1 antibody (ab169947)

Product name

Anti-LRR-1 antibody
See all LRR-1 primary antibodies
Description

Rabbit polyclonal to LRR-1
Host species

Rabbit
Tested applications

Suitable for: WB, IHC-Pmore details
Species reactivity

Reacts with: Human
Immunogen

Recombinant fragment corresponding to Human LRR-1 aa 95-242.
Sequence:
AISSSLKGFLSAMRLAHRGCNVDTPVSTLTPVKTSEFENFKTKMVITSKK DYPLSKNFPYSLEHLQTSYCGLVRVDMRMLCLKSLRKLDLSHNHIKKLPA TIGDLIHLQELNLNDNHLESFSVALCHSTLQKSLRSLDLSKNKIKALP

Database link: Q96L50

Run BLAST with Run BLAST with
Positive control
- Recombinant Human LRR-1 protein (ab165190) can be used as a positive control in WB. Human fetal brain lysate, NIH-3T3 cell lysate, Human pancreas cancer tissue.
General notes

Previously labelled as PPIL5.

Form

Lyophilised:Reconstitute in 200ul sterile water
Storage instructions

Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
Storage buffer

pH: 7.2
Preservative: 0.02% Sodium azide
Constituents: 98% PBS, 1% BSA
Concentration information loading...
Purity

Immunogen affinity purified
Clonality

Polyclonal
Isotype

IgG
Research areas

Our Abpromise guarantee covers the use of ab169947 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application	Abreviews	Notes
WB		1/500 - 1/1000. Detects a band of approximately 50 kDa (predicted molecular weight: 47 kDa).
IHC-P		1/100 - 1/500.

Function

May negatively regulate the 4-1BB-mediated signaling cascades which result in the activation of NK-kappaB and JNK1. Probable substrate recognition subunit of an ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.
Tissue specificity

Ubiquitous. Maximal expression was seen in the heart and skeletal muscle and minimal expression seen in the kidney.
Pathway

Protein modification; protein ubiquitination.
Sequence similarities

Contains 7 LRR (leucine-rich) repeats.
Target information above from: UniProt accession Q96L50 The UniProt Consortium
The Universal Protein Resource (UniProt) in 2010
Nucleic Acids Res. 38:D142-D148 (2010) .

Information by UniProt
Database links
- Entrez Gene: 122769 Human
- Omim: 609193 Human
- SwissProt: Q96L50 Human
- Unigene: 451090 Human
Alternative names
- 4 1BB mediated signaling molecule antibody
- 4 1BBlrr antibody
- 4-1BB-mediated-signaling molecule antibody
- 4-1BBlrr antibody
- Cyclophilin like 5 antibody
- Leucine-rich repeat protein 1 antibody
- LLR1_HUMAN antibody
- LRR 1 antibody
- LRR repeat protein 1 antibody
- LRR-1 antibody
- LRR-repeat protein 1 antibody
- LRR1 antibody
- MGC20689 antibody
- peptidylprolyl isomerase (cyclophilin) like 5 antibody
- Peptidylprolyl isomerase like 5 antibody
- Peptidylprolyl isomerase-like 5 antibody
- PPIL5 antibody
see all

Western blot - Anti-LRR-1 antibody (ab169947)

All lanes : Anti-LRR-1 antibody (ab169947) at 1/500 dilution

Lane 1 : Human fetal brain lysate
Lane 2 : NIH-3T3 cell lysate

Predicted band size: 47 kDa
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-LRR-1 antibody (ab169947)

Immunohistochemical analysis of Formalin/PFA-fixed paraffin-embedded Human pancreas cancer tissue labeling LRR-1 with ab169947 at 1/100 dilution

ab169947 has not yet been referenced specifically in any publications.

Publishing research using ab169947? Please let us know so that we can cite the reference in this datasheet.

Anti-LRR-1 antibody (ab169947)