Anti-LRR-1 antibody (ab169947)
Key features and details
- Rabbit polyclonal to LRR-1
- Suitable for: WB, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-LRR-1 antibody
See all LRR-1 primary antibodies -
Description
Rabbit polyclonal to LRR-1 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human LRR-1 aa 95-242.
Sequence:AISSSLKGFLSAMRLAHRGCNVDTPVSTLTPVKTSEFENFKTKMVITSKK DYPLSKNFPYSLEHLQTSYCGLVRVDMRMLCLKSLRKLDLSHNHIKKLPA TIGDLIHLQELNLNDNHLESFSVALCHSTLQKSLRSLDLSKNKIKALP
Database link: Q96L50 -
Positive control
- WB: Human fetal brain lysate and NIH-3T3 cell lysate; IHC: Human pancreas cancer tissue.
-
General notes
Previously labelled as PPIL5.
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Lyophilized:Reconstitute in 200ul sterile water -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 98% PBS, 1% BSA -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab169947 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/500 - 1/1000. Detects a band of approximately 50 kDa (predicted molecular weight: 47 kDa). | |
IHC-P | 1/100 - 1/500. |
Target
-
Function
May negatively regulate the 4-1BB-mediated signaling cascades which result in the activation of NK-kappaB and JNK1. Probable substrate recognition subunit of an ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. -
Tissue specificity
Ubiquitous. Maximal expression was seen in the heart and skeletal muscle and minimal expression seen in the kidney. -
Pathway
Protein modification; protein ubiquitination. -
Sequence similarities
Contains 7 LRR (leucine-rich) repeats. - Information by UniProt
-
Database links
- Entrez Gene: 122769 Human
- Omim: 609193 Human
- SwissProt: Q96L50 Human
- Unigene: 451090 Human
-
Alternative names
- 4 1BB mediated signaling molecule antibody
- 4 1BBlrr antibody
- 4-1BB-mediated-signaling molecule antibody
see all
Images
-
All lanes : Anti-LRR-1 antibody (ab169947) at 1/500 dilution
Lane 1 : Human fetal brain lysate
Lane 2 : NIH-3T3 cell lysate
Predicted band size: 47 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-LRR-1 antibody (ab169947)
Immunohistochemical analysis of Formalin/PFA-fixed paraffin-embedded Human pancreas cancer tissue labeling LRR-1 with ab169947 at 1/100 dilution
Protocols
References (0)
ab169947 has not yet been referenced specifically in any publications.