Overview

  • Product name

  • Description

    Rabbit polyclonal to LRR-1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human LRR-1 aa 256-330.
    Sequence:

    LDDNELIQFPCKIGQLINLRFLSAARNKLPFLPSEFRNLSLEYLDLFGNT FEQPKVLPVIKLQAPLTLLESSART


    Database link: Q96L50

  • Positive control

    • ICC/IF: PC-3 cells. WB: Human tonsil lysate.
  • General notes

    Previously labelled as PPIL5.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab221772 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

WB 1/100 - 1/250. Predicted molecular weight: 47 kDa.

Target

  • Function

    May negatively regulate the 4-1BB-mediated signaling cascades which result in the activation of NK-kappaB and JNK1. Probable substrate recognition subunit of an ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.
  • Tissue specificity

    Ubiquitous. Maximal expression was seen in the heart and skeletal muscle and minimal expression seen in the kidney.
  • Pathway

    Protein modification; protein ubiquitination.
  • Sequence similarities

    Contains 7 LRR (leucine-rich) repeats.
  • Information by UniProt
  • Database links

  • Alternative names

    • 4 1BB mediated signaling molecule antibody
    • 4 1BBlrr antibody
    • 4-1BB-mediated-signaling molecule antibody
    • 4-1BBlrr antibody
    • Cyclophilin like 5 antibody
    • Leucine-rich repeat protein 1 antibody
    • LLR1_HUMAN antibody
    • LRR 1 antibody
    • LRR repeat protein 1 antibody
    • LRR-1 antibody
    • LRR-repeat protein 1 antibody
    • LRR1 antibody
    • MGC20689 antibody
    • peptidylprolyl isomerase (cyclophilin) like 5 antibody
    • Peptidylprolyl isomerase like 5 antibody
    • Peptidylprolyl isomerase-like 5 antibody
    • PPIL5 antibody
    see all

Images

  • All lanes : Anti-LRR-1 antibody (ab221772) at 1/100 dilution

    Lane 1 : RT4 (human urinary bladder cancer cell line) cell lysate
    Lane 2 : U-251 MG (human brain glioma cell line) cell lysate
    Lane 3 : Human plasma
    Lane 4 : Human liver lysate
    Lane 5 : Human tonsil lysate

    Predicted band size: 47 kDa

  • PFA-fixed, Triton X-100 permeabilized PC-3 (human prostate adenocarcinoma cell line) cells stained for LRR-1 (green) using ab221772 at 4 µg/ml in ICC/IF.

References

ab221772 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221772.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up