Anti-LRRC10B antibody (ab188260)
Key features and details
- Rabbit polyclonal to LRRC10B
- Suitable for: ICC/IF, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-LRRC10B antibody -
Description
Rabbit polyclonal to LRRC10B -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat -
Immunogen
Recombinant fragment corresponding to Human LRRC10B aa 62-128.
Sequence:EIEELRELRILALDFNKLERLPDGLCRLPRLTRLYLGGNRLLALPADFAQ LQSLRCLWIEGNFLRRF
Database link: A6NIK2 -
Positive control
- IHC-P: Human prostate tissue. ICC/IF: RH-30 cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), 59% PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab188260 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ICC/IF | Use a concentration of 0.25 - 2 µg/ml. | |
IHC-P | 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Sequence similarities
Contains 9 LRR (leucine-rich) repeats. - Information by UniProt
-
Database links
- Entrez Gene: 390205 Human
- Entrez Gene: 278795 Mouse
- Entrez Gene: 309208 Rat
- SwissProt: A6NIK2 Human
- Unigene: 441122 Human
-
Alternative names
- Leucine-rich repeat-containing protein 10B antibody
- LR10B_HUMAN antibody
- LRRC10 like protein ENSP00000367315 antibody
- LRRC10B antibody
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-LRRC10B antibody (ab188260)
Paraffin embedded human prostatic tissue stained for LRRC10B using ab188260 at 1/50 dilution in immunohistochemical analysis.
Heat mediated antigen retrieval was performed with citrate buffer pH 6 before the IHC staining protocol.
-
RH-30 cells stained for LRRC10B (green) using ab188260 at 2 µg/ml in ICC/IF.
Datasheets and documents
References (0)
ab188260 has not yet been referenced specifically in any publications.