Overview

  • Product name

  • Description

    Rabbit polyclonal to LRRC20
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant full length protein corresponding to Human LRRC20 aa 1-184.
    Sequence:

    MLKKMGEAVARVARKVNETVESGSDTLDLAECKLVSFPIGIYKVLRNVSG QIHLITLANNELKSLTSKFMTTFSQLRELHLEGNFLHRLPSEVSALQHLK AIDLSRNQFQDFPEQLTALPALETINLEENEIVDVPVEKLAAMPALRSIN LRFNPLNAEVRVIAPPLIKFDMLMSPEGARAPLP


    Database link: Q8TCA0-1

  • Positive control

    • WB: Jurkat and U937 whole cell lysate; Mouse heart and spleen tissue lysate. IHC-P: Human gastric cancer and testis tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Do Not Freeze.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab235521 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000.
IHC-P 1/20 - 1/200.

Target

Images

  • Paraffin-embedded human gastric cancer tissue stained for LRRC20 using ab235521 at 1/100 dilution in immunohistochemical analysis.

  • All lanes : Anti-LRRC20 antibody (ab235521) at 1/1000 dilution

    Lane 1 : Jurkat (human T cell leukemia cell line from peripheral blood) whole cell lysate
    Lane 2 : Mouse heart tissue lysate
    Lane 3 : Mouse spleen tissue lysate
    Lane 4 : U937 (Human histiocytic lymphoma cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to Rabbit IgG at 1/10000 dilution
  • Paraffin-embedded human testis tissue stained for LRRC20 using ab235521 at 1/100 dilution in immunohistochemical analysis.

References

ab235521 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235521.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up