Overview

  • Product name

    Anti-LRRC25/MAPA antibody [OTI1D9]
    See all LRRC25/MAPA primary antibodies
  • Description

    Mouse monoclonal [OTI1D9] to LRRC25/MAPA
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IF, Flow Cytmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human LRRC25/MAPA aa 1-305. Produced in HEK-293T cell (NP_660299).
    Sequence:

    MGGTLAWTLLLPLLLRESDSLEPSCTVSSADVDWNAEFSATCLNFSGLSL SLPHNQSLRASNVILLDLSGNGLRELPVTFFAHLQKLEVLNVLRNPLSRV DGALAARCDLDLQADCNCALESWHDIRRDNCSGQKPLLCWDTTSSQHNLS AFLEVSCAPGLASATIGAVVVSGCLLLGLAIAGPVLAWRLWRCRVARSRE LNKPWAAQDGPKPGLGLQPRYGSRSAPKPQVAVPSCPSTPDYENMFVGQP AAEHQWDEQGAHPSEDNDFYINYKDIDLASQPVYCNLQSLGQAPMDEEEY VIPGH


    Database link: Q8N386

  • Positive control

    • WB: pCMV6-ENTRY LRRC25/MAPA transfected HEK-293T cells. IHC-P: Human lung carcinoma, endometrium adenocarcinoma and lymphoma tissue. ICC/IF: pCMV6-ENTRY LRRC25/MAPA transfected COS-7 cells Flow: HEK-293T cells transfected with overexpressing plasmid.
  • General notes

    Clone OTI1D9 (formerly 1D9).

     This product was previously labelled as LRRC25

     

Properties

Applications

Our Abpromise guarantee covers the use of ab236395 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000. Predicted molecular weight: 33 kDa.
IHC-P 1/150. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF 1/100.
Flow Cyt 1/100.

Target

  • Relevance

    LRRC25 is a single-pass type I membrane protein. It contains 2 LRR (leucine-rich) repeats. LRRC25 may be involved in the activation of cells of innate and acquired immunity.
  • Cellular localization

    Membrane; Single-pass type I membrane protein.
  • Database links

  • Alternative names

    • FLJ38116 antibody
    • Leucine rich repeat containing 25 antibody
    • Leucine rich repeat containing protein 25 antibody
    • LRRC 25 antibody
    • MAPA antibody
    • Monocyte and plasmacytoid activated molecule antibody
    see all

Images

  • All lanes : Anti-LRRC25/MAPA antibody [OTI1D9] (ab236395) at 1/2000 dilution

    Lane 1 : pCMV6-ENTRY control transfected HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate
    Lane 2 : pCMV6-ENTRY LRRC25/MAPA transfected HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 33 kDa

  • Paraffin-embedded human lung carcinoma tissue stained for LRRC25/MAPA using ab236395 at 1/150 in immunohistochemical analysis.

     

  • COS-7 (African green monkey kidney fibroblast-like cell line) cells transfected with pCMV6-ENTRY LRRC25/MAPA labeling LRRC25/MAPA using ab236395 at 1/100 dilution in ICC/IF.

  • Flow cytometric analysis of HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) cells transfected with either overexpress plasmid (Red) or empty vector control plasmid (Blue).

  • Paraffin-embedded human lymphoma tissue stained for LRRC25/MAPA using ab236395 at 1/150 in immunohistochemical analysis.

  • Paraffin-embedded human endometrium adenocarcinoma tissue stained for LRRC25/MAPA using ab236395 at 1/150 in immunohistochemical analysis.

References

ab236395 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236395.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up