Anti-LRRC42 antibody (ab235316)
Key features and details
- Rabbit polyclonal to LRRC42
- Suitable for: WB, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-LRRC42 antibody -
Description
Rabbit polyclonal to LRRC42 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human LRRC42 aa 201-428.
Sequence:SSVTQLHLKDNCLSDAGVRKMTAPVRVMKRGLENLTLLDLSCNPEITDAG IGYLFSFRKLNCLDISGTGLKDIKTVKHKLQTHIGLVHSKVPLKEFDHSN CKTEGWADQIVLQWERVTAEAVKPRETSEPRAAAQRFYGKRSRAEAPLKC PLADTHMNSSEKLQFYKEKAPDCHGPVLKHEAISSQESKKSKKRPFEESE TEQNNSSQPSKQKYVCLAVEDWDLLNSY
Database link: Q9Y546 -
Positive control
- WB: MCF7, A549, HCT 116 and COLO 320 whole cell lysates. IHC-P: Human placenta and small intestine tissue.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Constituents: PBS, 50% Glycerol (glycerin, glycerine), 0.03% Proclin 300 -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
Purity >95%. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
Our Abpromise guarantee covers the use of ab235316 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/1000 - 1/5000. Detects a band of approximately 49 kDa (predicted molecular weight: 49 kDa). | |
IHC-P | 1/20 - 1/200. |
Target
-
Database links
- Entrez Gene: 115353 Human
- SwissProt: Q9Y546 Human
- Unigene: 40094 Human
-
Alternative names
- dJ167A19.4 antibody
- Leucine rich repeat containing 42 antibody
- Leucine rich repeat containing protein 42 antibody
see all
Images
-
All lanes : Anti-LRRC42 antibody (ab235316) at 1/1000 dilution
Lane 1 : MCF7 (human breast adenocarcinoma cell line) whole cell lysate
Lane 2 : A549 (human lung carcinoma cell line) whole cell lysate
Lane 3 : HCT 116 (human colorectal carcinoma cell line) whole cell lysate
Lane 4 : COLO 320 whole cell lysate
Secondary
All lanes : Goat polyclonal to Rabbit IgG at 1/10000 dilution
Predicted band size: 49 kDa
Observed band size: 49 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-LRRC42 antibody (ab235316)
Paraffin-embedded human placenta tissue stained for LRRC42 using ab235316 at 1/100 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-LRRC42 antibody (ab235316)
Paraffin-embedded human small intestine tissue stained for LRRC42 using ab235316 at 1/100 dilution in immunohistochemical analysis.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
References (0)
ab235316 has not yet been referenced specifically in any publications.