
  • Product name

    Anti-LRRC50 antibody
  • Description

    Rabbit polyclonal to LRRC50
  • Host species

  • Tested applications

    Suitable for: WB, ELISA, ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Horse, Chicken, Guinea pig, Cow, Cat, Dog
  • Immunogen

    A synthetic peptide corresponding to a region of Human LRRC50. The immunogen is found within the following sequence which corresponds to aa 151-200 of the human protein: TELRCLFLQMNLLRKIENLEPLQKLDALNLSNNYIKTIENLSCLPVLNTL .

  • Positive control

    • 721_B cell lysate



Our Abpromise guarantee covers the use of ab75163 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Detects a band of approximately 80 kDa (predicted molecular weight: 80 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay 1:1562500.

ICC/IF Use at an assay dependent concentration. PubMed: 23599692
IHC-P Use at an assay dependent concentration. PubMed: 23599692


  • Relevance

    LRRC50 contains six LRR (leucine-rich) repeats. It is proposed that LRRC50 is a novel candidate gene for human cystic kidney disease, involved in regulation of microtubule-based cilia and actin-based brush border microvilli.
  • Cellular localization

    Cell projection; cilium. Cytoplasm. Cytoplasm; cytoskeleton, spindle pole. Note: In HEK293T cells, it is diffusely cytoplasmic and concentrates at the mitotic spindle poles, while in MDCK cells, it localizes in the cilium. In vivo, this protein is probably restricted to the cilium.
  • Database links

  • Alternative names

    • CILD13 antibody
    • DNAAF1 antibody
    • Dynein assembly factor 1, axonemal antibody
    • Leucine rich repeat containing 50 antibody
    • ODA7 antibody
    see all


  • Anti-LRRC50 antibody (ab75163) at 1 µg/ml + 721_B cell lysate at 10 µg

    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 80 kDa
    Observed band size: 80 kDa

    Gel concentration: 12%


This product has been referenced in:

  • Hartill VL  et al. DNAAF1 links heart laterality with the AAA+ ATPase RUVBL1 and ciliary intraflagellar transport. Hum Mol Genet 27:529-545 (2018). Read more (PubMed: 29228333) »
  • Basten SG  et al. Mutations in LRRC50 predispose zebrafish and humans to seminomas. PLoS Genet 9:e1003384 (2013). IHC-P, ICC/IF ; Human, Zebrafish . Read more (PubMed: 23599692) »
See all 2 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab75163.
Please use the links above to contact us or submit feedback about this product.

For licensing inquiries, please contact partnerships@abcam.com

Sign up