Overview

  • Product name

  • Description

    Rabbit polyclonal to LRRC57
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Fusion protein corresponding to Human LRRC57 aa 1-239. Full length fusion protein. The protein fusion partner is GST. Gene Accssion: BC058935.
    Sequence:

    MGNSALRAHVETAQKTGVFQLKDRGLTEFPADLQKLTSNLRTIDLSNNKI ESLPPLLIGKFTLLKSLSLNNNKLTVLPDEICNLKKLETLSLNNNHLREL PSTFGQLSALKTLSLSGNQLALPPQLCSLRHLDVMDLSKNQIRSIPDSVG ELQVIELNLNQNQISQISVKISCCPRLKILRLEENCLELSMLPQSILSDS QICLLAVEGNLFEIKKLRELEGYDKYMERFTATKKKFA


    Database link: Q8N9N7

  • Positive control

    • HT-29 cell lysate; Human thyroid cancer tissue

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.3
    Preservative: 0.05% Sodium azide
    Constituents: 49% PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab198002 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/200 - 1/1000. Predicted molecular weight: 26 kDa.
IHC-P 1/50 - 1/200.

Target

Images

  • Immunohistochemical analysis of paraffin-embedded Human thyroid cancer tissue labeling LRRC57 using ab198002 at 1/40 dilution.

  • Anti-LRRC57 antibody (ab198002) at 1/200 dilution + HT-29 cell lysate at 40 µg

    Predicted band size: 26 kDa


    Exposure time: 5 minutes


    Gel: 10%SDS-PAGE

References

ab198002 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198002.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up