Overview

  • Product name

    Anti-LRRC8E antibody
  • Description

    Rabbit polyclonal to LRRC8E
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human LRRC8E aa 294-490. BC022216.
    Sequence:

    EVPLWVFGLRGLEELHLEGLFPQELARAATLESLRELKQLKVLSLRSNAG KVPASVTDVAGHLQRLSLHNDGARLVALNSLKKLAALRELELVACGLERI PHAVFSLGALQELDLKDNHLRSIEEILSFQHCRKLVTLRLWHNQIAYVPE HVRKLRSLEQLYLSYNKLETLPSQLGLCSGLRLLDVSHNGLHSLPPE


    Database link: BC022216

  • Positive control

    • HepG2 cell lysate.

Properties

  • Form

    Lyophilised:Reconstitute in 200µl sterile H2O.
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 1% BSA, 98% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab201188 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1000. Predicted molecular weight: 90 kDa.

Target

  • Relevance

    LRRC8E (Leucine-rich repeat-containing protein 8E) is a multi-pass membrane protein which contains 13 LRR (leucine-rich) repeats.
  • Cellular localization

    Membrane; Multi-pass membrane protein
  • Database links

  • Alternative names

    • FLJ23420 antibody
    • Leucine rich repeat containing 8 family member E antibody
    • Leucine rich repeat containing protein 8E antibody
    • Volume regulated anion channel subunit LRRC8E antibody

Images

  • Anti-LRRC8E antibody (ab201188) at 1/1000 dilution + HepG2 cell lysate

    Predicted band size: 90 kDa

References

ab201188 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab201188.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up