Overview

  • Product name
  • Description
    Rabbit polyclonal to LRRFIP1
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IPmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide within Human LRRFIP1 aa 758-808 (C terminal). The exact sequence is proprietary. (NP_001131024.1).
    Sequence:

    QTVRKALDSNSLENDDLSAPGREPGHFNPESREDTRGGNEKGKSKEDCTM S


    Database link: Q32MZ4

  • Positive control
    • HeLa and 293T whole cell lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab176587 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000 - 1/10000. Predicted molecular weight: 89 kDa.
IP Use at 2-5 µg/mg of lysate.

Target

  • Function
    Transcriptional repressor which preferentially binds to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA. May control smooth muscle cells proliferation following artery injury through PDGFA repression. May also bind double-stranded RNA.
  • Tissue specificity
    Ubiquitously expressed.
  • Sequence similarities
    Belongs to the LRRFIP family.
  • Developmental stage
    Widely expressed in fetal tissues.
  • Cellular localization
    Nucleus. Cytoplasm.
  • Information by UniProt
  • Database links
  • Alternative names
    • FLAP 1 antibody
    • FLAP1 antibody
    • FLIIAP 1 antibody
    • FLIIAP1 antibody
    • GC binding factor 2 antibody
    • GC-binding factor 2 antibody
    • GCF 2 antibody
    • GCF2 antibody
    • HUFI 1 antibody
    • HUFI1 antibody
    • Leucine rich repeat (in FLII) interacting protein 1 antibody
    • Leucine rich repeat flightless interacting protein 1 antibody
    • Leucine-rich repeat flightless-interacting protein 1 antibody
    • LRR FLII interacting protein 1 antibody
    • LRR FLII-interacting protein 1 antibody
    • LRRF1_HUMAN antibody
    • LRRFIP 1 antibody
    • Lrrfip1 antibody
    • MGC10947 antibody
    • MGC119738 antibody
    • MGC119739 antibody
    • NEDD8 conjugating enzyme antibody
    • TAR RNA interacting protein antibody
    • TAR RNA-interacting protein antibody
    • Transcription factor 9 like antibody
    • TRIP antibody
    see all

Images

  • Detection of LRRFIP1 in Immunoprecipitates of HeLa whole cell lysate (1 mg for IP, 20% of IP loaded) using ab176587 at 6 µg/mg lysate for IP (Lane 1). For WB detection ab176587 was used at 0.4 µg/ml. Lane 2 represents control IgG IP.

    Detection: Chemiluminescence with an exposure time of 1 second.

  • All lanes : Anti-LRRFIP1 antibody (ab176587) at 0.04 µg/ml

    Lane 1 : HeLa whole cell lysate at 50 µg
    Lane 2 : HeLa whole cell lysate at 15 µg
    Lane 3 : HeLa whole cell lysate at 5 µg
    Lane 4 : 293T whole cell lysate at 50 µg

    Developed using the ECL technique.

    Predicted band size: 89 kDa


    Exposure time: 30 seconds

References

ab176587 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab176587.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up