Overview

  • Product name

  • Description

    Rabbit polyclonal to LSD2 / AOF1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human LSD2/ AOF1 aa 451-544.
    Sequence:

    CEQLGISMHKFGERCDLIQEGGRITDPTIDKRMDFHFNALLDVVSEWRKD KTQLQDVPLGEKIEEIYKAFIKESGIQFSELEGQVLQFHLSNLE


    Database link: Q8NB78

  • Positive control

    • IHC-P: Human liver tissue. ICC/IF: A431 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab246977 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

Target

  • Function

    Histone demethylase that demethylates 'Lys-4' of histone H3, a specific tag for epigenetic transcriptional activation, thereby acting as a corepressor. Required for de novo DNA methylation of a subset of imprinted genes during oogenesis. Acts by oxidizing the substrate by FAD to generate the corresponding imine that is subsequently hydrolyzed. Demethylates both mono- and di-methylated 'Lys-4' of histone H3. Has no effect on tri-methylated 'Lys-4', mono-, di- or tri-methylated 'Lys-9', mono-, di- or tri-methylated 'Lys-27', mono-, di- or tri-methylated 'Lys-36' of histone H3, or on mono-, di- or tri-methylated 'Lys-20' of histone H4.
  • Sequence similarities

    Belongs to the flavin monoamine oxidase family.
    Contains 1 CW-type zinc finger.
    Contains 1 SWIRM domain.
  • Domain

    The SWIRM domain may act as an anchor site for a histone tail.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Form

    There are 3 isoforms produced by alternative splicing.
  • Alternative names

    • amine oxidase (flavin containing) domain 1 antibody
    • amine oxidase, flavin containing 1 antibody
    • AOF1 antibody
    • bA204B7.3 antibody
    • C6orf193 antibody
    • dJ298J15.2 antibody
    • Flavin-containing amine oxidase domain-containing protein 1 antibody
    • FLJ33898 antibody
    • FLJ34109 antibody
    • FLJ43328 antibody
    • KDM1B antibody
    • KDM1B_HUMAN antibody
    • LSD2 antibody
    • lysine (K)-specific demethylase 1B antibody
    • Lysine-specific demethylase 2 antibody
    • Lysine-specific histone demethylase 1B antibody
    • Lysine-specific histone demethylase 2 antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized A431 (human epidermoid carcinoma cell line) cells stained for LSD2 / AOF1 (green) using ab246977 at 4 μg/ml in ICC/IF.

  • Paraffin-embedded human liver tissue stained for LSD2 / AOF1 using ab246977 at 1/20 dilution in immunohistochemical analysis.

References

ab246977 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab246977.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up