Overview

  • Product name

  • Description

    Rabbit polyclonal to LSDP5
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human LSDP5 aa 305-453.
    Sequence:

    VRGLPAGAQEKVAEVRRSVDALQTAFADARCFRDVPAAALAEGRGRVAHA HACVDELLELVVQAVPLPWLVGPFAPILVERPEPLPDLADLVDEVIGGPD PRWAHLDWPAQQRAWEAEHRDGSGNGDGDRMGVAGDICEQEPETPSCPV


    Database link: Q00G26

  • Positive control

    • WB: Mouse kidney and brain lysates. ICC/IF: HepG2 (human liver hepatocellular carcinoma cell line) cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab222811 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Detects a band of approximately 51, 36 kDa (predicted molecular weight: 51 kDa).
ICC/IF 1/50 - 1/200.

Target

Images

  • HepG2 (human liver hepatocellular carcinoma cell line) cells stained for LSDP5 (green) using ab222811 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).

  • All lanes : Anti-LSDP5 antibody (ab222811) at 1/1000 dilution

    Lane 1 : Mouse kidney lysate
    Lane 2 : Mouse brain lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 51 kDa

References

ab222811 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Mouse Tissue sections (Brown Adipose Tissue)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: Sodium Citrate
Permeabilization
No
Specification
Brown Adipose Tissue
Blocking step
Fish Skin Gelatin as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 0.2% · Temperature: 23°C
Fixative
Paraformaldehyde

Dr. Alice Pollard

Verified customer

Submitted Jun 01 2018

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up