Overview

  • Product name

  • Description

    Rabbit polyclonal to LSM1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Cow
  • Immunogen

    Recombinant full length protein corresponding to Human LSM1 aa 1-133.
    Sequence:

    MNYMPGTASLIEDIDKKHLVLLRDGRTLIGFLRSIDQFANLVLHQTVERI HVGKKYGDIPRGIFVVRGENVVLLGEIDLEKESDTPLQQVSIEEILEEQR VEQQTKLEAEKLKVQALKDRGLSIPRADTLDEY


    Database link: O15116

  • Positive control

    • IHC-P: Human brain and prostate tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab238592 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Plays a role in replication-dependent histone mRNA degradation. Binds specifically to the 3'-terminal U-tract of U6 snRNA.
  • Tissue specificity

    Has elevated expression in pancreatic cancer and in several cancer-derived cell lines.
  • Sequence similarities

    Belongs to the snRNP Sm proteins family.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Cancer associated Sm like protein antibody
    • Cancer associated Sm-like antibody
    • Cancer-associated Sm-like antibody
    • CASM antibody
    • lsm1 antibody
    • LSM1 antibody antibody
    • LSM1 homolog, U6 small nuclear RNA associated (S. cerevisiae) antibody
    • Lsm1 protein antibody
    • LSM1, U6 small nuclear RNA associated antibody
    • LSM1_HUMAN antibody
    • Small nuclear ribonuclear CaSm antibody
    • U6 snRNA associated Sm-like protein LSm1 antibody
    • U6 snRNA-associated Sm-like protein LSm1 antibody
    • YJL124C antibody
    see all

Images

  • Paraffin-embedded human brain tissue stained for LSM1 using ab238592 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human prostate tissue stained for LSM1 using ab238592 at 1/100 dilution in immunohistochemical analysis.

References

ab238592 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238592.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up