Overview

  • Product name

  • Description

    Rabbit polyclonal to LSM11
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human LSM11 aa 143-307. (BC126449).
    Sequence:

    NVLTRMPLHEGSPLGELHRCIREGVKVNVHIRTFKGLRGVCTGFLVAFDK FWNMALTDVDETYRKPVLGKAYERDSSLTLTRLFDRLKLQDSSKKEADSK SAVEDSTLSRYSQTSTWKLASVWGRADTGRGSHKRSRSVPSSLQASAREE SRSELSGRTTRTDGS


    Database link: P83369

  • Positive control

    • HeLa, Jurkat and HepG2 cell lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab201159 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/500. Predicted molecular weight: 40 kDa.

Target

  • Relevance

    LSM11 is a 39.5 kDa protein that is a component of a specialized SMN complex also containing Lsm10. Lsm11 not only specifies the assembly of the U7 Sm core but also fulfills an important role in U7 snRNP-mediated histone mRNA processing.
  • Cellular localization

    Nuclear
  • Database links

  • Alternative names

    • 2210404M20Rik antibody
    • LSM11 homolog, U7 small nuclear RNA associated antibody
    • LSM11, U7 small nuclear RNA associated antibody
    • U7 snRNA-associated Sm-like protein LSm11 antibody

Images

  • All lanes : Anti-LSM11 antibody (ab201159) at 1/500 dilution

    Lane 1 : HeLa cell lysate
    Lane 2 : Jurkat cell lysate
    Lane 3 : HepG2 cell lysate

    Predicted band size: 40 kDa

References

ab201159 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab201159.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up