Overview

  • Product name

  • Description

    Rabbit polyclonal to LSM4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Cow
  • Immunogen

    Recombinant full length protein corresponding to Human LSM4 aa 1-139.
    Sequence:

    MLPLSLLKTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDG DKFWRMPECYIRGSTIKYLRIPDEIIDMVKEEVVAKGRGRGGLQQQKQQK GRGMGGAGRGVFGGRGRGGIPGTGRGQPEKKPGRQAGKQ


    Database link: Q9Y4Z0

  • Positive control

    • WB: A549 and K562 whole cell lysates. IHC-P: Human adrenal gland tissue. ICC/IF: MCF7 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab236744 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/500 - 1/2000. Predicted molecular weight: 15 kDa.
ICC/IF 1/50 - 1/200.

Target

  • Relevance

    Sm like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family. Sm like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm like proteins are thought to form a stable heteromer present in tri snRNP particles, which are important for pre mRNA splicing.
  • Cellular localization

    Nuclear
  • Database links

  • Alternative names

    • Glycine rich protein antibody
    • GRP antibody
    • LSM 4 antibody
    • LSM4 homolog antibody
    • LSM4 homolog U6 small nuclear RNA associated (S. cerevisiae) antibody
    • LSM4 homolog U6 small nuclear RNA associated antibody
    • U6 small nuclear RNA associated antibody
    • U6 snRNA associated Sm like protein 4 antibody
    • U6 snRNA associated Sm like protein antibody
    • U6 snRNA associated Sm like protein LSm 4 antibody
    • U6 snRNA associated Sm like protein LSm4 antibody
    • YER 112W antibody
    • YER112W antibody
    see all

Images

  • All lanes : Anti-LSM4 antibody (ab236744) at 1/500 dilution

    Lane 1 : A549 (Human lung carcinoma cell line) whole cell lysate
    Lane 2 : K562 (Human chronic myelogenous leukemia cell line from bone marrow) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 15 kDa

  • Paraffin-embedded human adrenal gland tissue stained for LSM4 using ab236744 at 1/100 dilution in immunohistochemical analysis.

  • MCF7 (Human breast adenocarcinoma cell line) cells stained for LSM4 (green) using ab236744 at 1/100 dilution in ICC/IF. Secondary antibody is an Alexa-Fluor® 488-conjugated Goat Anti-Rabbit IgG (H+L).

References

ab236744 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236744.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up