Overview

  • Product name

  • Description

    Rabbit polyclonal to LSM7
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant full length protein corresponding to Human LSM7 aa 2-103.
    Sequence:

    ADKEKKKKESILDLSKYIDKTIRVKFQGGREASGILKGFDPLLNLVLDGT IEYMRDPDDQYKLTEDTRQLGLVVCRGTSVVLICPQDGMEAIPNPFIQQQ DA


    Database link: Q9UK45

  • Positive control

    • WB: Caco-2 whole cell lysate. IHC-P: Human testis tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab235332 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000.
IHC-P 1/20 - 1/200.

Target

Images

  • Anti-LSM7 antibody (ab235332) at 1/1000 dilution + Caco-2 (Human colorectal adenocarcinoma cell line) whole cell lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/10000 dilution
  • Paraffin-embedded human testis tissue stained for LSM7 with ab235332 (1/100 dilution) in immunohistochemical analysis.

References

ab235332 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235332.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up