Overview

  • Product name
    Anti-LSMD1 antibody
  • Description
    Rabbit polyclonal to LSMD1
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity
    Reacts with: Mouse, Human
  • Immunogen

    Recombinant full length protein corresponding to Human LSMD1 aa 2-173. Full length chain of isoform 2
    Sequence:

    MAVAVGVRAAPVLGLARALVLGLRGSQAARWRGWGTAAPGSLWALCECPA GCRELWFRGRAAWAARSERLLHPAQDSDGEREDSAAERARQQLEALLNKT MRIRMTDGRTLVGCFLCTDRDCNVILGSAQEFLKPSDSFSAGEPRVLGLA MVPGHHIVSIEVQRESLTGPPYL


    Database link: Q9BRA00-2

  • Positive control
    • WB: Mouse kidney tissue lysate. IHC-P: Human kidney tissue. ICC/IF: PC-3 cells.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity
    Protein G purified
  • Purification notes
    Purity >95%
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab236965 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000.
IHC-P 1/100 - 1/500.
ICC/IF 1/50 - 1/500.

Target

Images

  • PC-3 (human prostate adenocarcinoma cell line) cells stained for LSMD1 (Green) using ab236965 at 1/133 dilution in ICC/IF, followed by Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG (H+L) secondary antibody.

    The cells were fixed in 4% formaldehyde, permeabilized tissue using 0.2% Triton X-100 and blocked in 10% normal goat serum. The cells were then incubated with the antibody overnight at 4°C. Counterstained with DAPI.

  • Paraffin-embedded human kidney tissue stained for LSMD1 using ab236965 at 1/400 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum for 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized tissue using an HRP conjugated SP system.

  • Anti-LSMD1 antibody (ab236965) at 1/500 dilution + Mouse kidney tissue lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/50000 dilution

References

ab236965 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236965.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up