Overview

  • Product name

  • Description

    Rabbit polyclonal to LSP1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Rat LSP1 aa 127-331. Expressed in E. coli.
    Sequence:

    SHQAKVHLEESNLSHSDPNIEDDVGGSGETEEHLISHQARTPSPLALEDT AELSSPPLSPTVKLADRTESLNRSIQKSNSVKKSQPTLPISTIDERLQQY TQATESAGRTPKLSRQPSIELPSMAVASTKTLWETGEVQTQSASKTPSCQ DIVAGDMSKKSLWEQKGGSKISSTIKSTPSGKRYKFVATGHGKYEKVLVD EGSAP


    Database link: Q4QQV6

  • Positive control

    • WB: Recombinant rat LSP1 protein. Rat lung and spleen tissue. IHC-P: Rat adrenal gland, kidney, lymph node and small intestine tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.05% Proclin
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231062 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    May play a role in mediating neutrophil activation and chemotaxis.
  • Tissue specificity

    Activated T-lymphocytes.
  • Post-translational
    modifications

    Phosphorylated by casein kinase II, protein kinase C and MAPKAPK2. Phosphorylation by PKC induces translocation from membrane to cytoplasm. Phosphorylation by MAPKAPK2 may regulate neutrophil chemotaxis.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • 47 kDa actin binding protein antibody
    • 47 kDa actin-binding protein antibody
    • 52 kDa phosphoprotein antibody
    • F actin binding and cytoskeleton associated protein antibody
    • Leufactin (leukocyte F-actin binding protein) antibody
    • Leufactin antibody
    • Leukocyte F actin binding protein antibody
    • Leukocyte specific protein 1 antibody
    • LSP 1 antibody
    • Lsp1 antibody
    • LSP1_HUMAN antibody
    • Lymphocyte specific antigen WP34 antibody
    • Lymphocyte specific protein 1 antibody
    • Lymphocyte specific protein pp52 antibody
    • Lymphocyte-specific antigen WP34 antibody
    • Lymphocyte-specific protein 1 antibody
    • OTTHUMP00000014138 antibody
    • OTTHUMP00000014139 antibody
    • OTTHUMP00000014140 antibody
    • OTTHUMP00000069612 antibody
    • OTTHUMP00000069614 antibody
    • OTTHUMP00000069615 antibody
    • OTTHUMP00000069616 antibody
    • pp52 antibody
    • Protein pp52 antibody
    • S37 protein antibody
    • WP 34 antibody
    • WP34 antibody
    see all

Images

  • All lanes : Anti-LSP1 antibody (ab231062) at 1 µg/ml

    Lane 1 : Rat lung tissue lysate
    Lane 2 : Rat spleen tissue lysate

    Secondary
    All lanes : HRP-linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Developed using the ECL technique.
  • Formalin-fixed, paraffin-embedded rat kidney tissue stained for LSP1 with ab231062 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded rat adrenal gland tissue stained for LSP1 with ab231062 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded rat small intestine tissue stained for LSP1 with ab231062 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded rat lymph node tissue stained for LSP1 with ab231062 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-LSP1 antibody (ab231062) at 2 µg/ml + recombinant rat LSP1 protein

    Developed using the ECL technique.

References

ab231062 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231062.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up