Overview

  • Product name
  • Description
    Mouse polyclonal to LSR
  • Host species
    Mouse
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Full length protein corresponding to Human LSR aa 1-649.
    Sequence:

    MQQDGLGVGTRNGSGKGRSVHPSWPWCAPRPLRYFGRDARARRAQTAAMA LLAGGLSRGLGSHPAAAGRDAVVFVWLLLSTWCTAPARAIQVTVSNPYHV VILFQPVTLPCTYQMTSTPTQPIVIWKYKSFCRDRIADAFSPASVDNQLN AQLAAGNPGYNPYVECQDSVRTVRVVATKQGNAVTLGDYYQGRRITITGN ADLTFDQTAWGDSGVYYCSVVSAQDLQGNNEAYAELIVLGRTSGVAELLP GFQAGPIEDWLFVVVVCLAAFLIFLLLGICWCQCCPHTCCCYVRCPCCPD KCCCPEALYAAGKAATSGVPSIYAPSTYAHLSPAKTPPPPAMIPMGPAYN GYPGGYPGDVDRSSSAGGQGSYVPLLRDTDSSVASEVRSGYRIQASQQDD SMRVLYYMEKELANFDPSRPGPPSGRVERAMSEVTSLHEDDWRSRPSRGP ALTPIRDEEWGGHSPRSPRGWDQEPAREQAGGGWRARRPRARSVDALDDL TPPSTAESGSRSPTSNGGRSRAYMPPRSRSRDDLYDQDDSRDFPRSRDPH YDDFRSRERPPADPRSHHHRTRDPRDNGSRSGDLPYDGRLLEEAVRKKGS EERRRPHKEEEEEAYYPPAPPPYSETDSQASRERRLKKNLALSRESLVV


    Database link: NP_991403

  • Positive control
    • WB: LSR-transfected 293T cell lysate.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term.
  • Storage buffer
    pH: 7.20
    Constituent: 100% PBS
  • Concentration information loading...
  • Purity
    Protein A purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab169583 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 71 kDa.

Target

  • Function
    Probable role in the clearance of triglyceride-rich lipoprotein from blood. Binds chylomicrons, LDL and VLDL in presence of free fatty acids and allows their subsequent uptake in the cells.
  • Sequence similarities
    Belongs to the immunoglobulin superfamily. LISCH7 family.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localization
    Cell membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • ILDR3 antibody
    • Immunoglobulin like domain containing receptor 3 antibody
    • Lipolysis Stimulated Lipoprotein Receptor antibody
    • Lipolysis stimulated remnant antibody
    • Lipolysis-stimulated lipoprotein receptor antibody
    • LISCH antibody
    • LISCH protein antibody
    • LISCH7 antibody
    • Liver specific bHLH Zip transcription factor antibody
    • LSR antibody
    • LSR_HUMAN antibody
    • MGC10659 antibody
    • MGC48312 antibody
    • MGC48503 antibody
    see all

Images

  • All lanes : Anti-LSR antibody (ab169583) at 1 µg/ml

    Lane 1 : LSR-transfected 293T cell lysate
    Lane 2 : Non-transfected 293T cell lysate

    Lysates/proteins at 15 µl per lane.

    Secondary
    All lanes : Goat Anti-Mouse IgG (H&L)-HRP at 1/2500 dilution

    Developed using the ECL technique.

    Predicted band size: 71 kDa

References

ab169583 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab169583.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up