Overview

  • Product name

  • Description

    Rabbit polyclonal to LSR
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human LSR aa 431-540.
    Sequence:

    MSEVTSLHEDDWRSRPSRGPALTPIRDEEWGGHSPRSPRGWDQEPAREQA GGGWRARRPRARSVDALDDLTPPSTAESGSRSPTSNGGRSRAYMPPRSRS RDDLYDQDDS


    Database link: Q86X29

  • Positive control

    • WB: Caco-2 cell lysate. IHC-P: Human stomach, placenta, endometrium, liver and testis tissues. ICC/IF: A431 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224237 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

WB 1/100 - 1/250. Predicted molecular weight: 71 kDa.
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Probable role in the clearance of triglyceride-rich lipoprotein from blood. Binds chylomicrons, LDL and VLDL in presence of free fatty acids and allows their subsequent uptake in the cells.
  • Sequence similarities

    Belongs to the immunoglobulin superfamily. LISCH7 family.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • ILDR3 antibody
    • Immunoglobulin like domain containing receptor 3 antibody
    • Lipolysis Stimulated Lipoprotein Receptor antibody
    • Lipolysis stimulated remnant antibody
    • Lipolysis-stimulated lipoprotein receptor antibody
    • LISCH antibody
    • LISCH protein antibody
    • LISCH7 antibody
    • Liver specific bHLH Zip transcription factor antibody
    • LSR antibody
    • LSR_HUMAN antibody
    • MGC10659 antibody
    • MGC48312 antibody
    • MGC48503 antibody
    see all

Images

  • Anti-LSR antibody (ab224237) at 1/100 dilution + Caco-2 (human colorectal adenocarcinoma cell line) cell lysate

    Developed using the ECL technique.

    Predicted band size: 71 kDa

  • PFA-fixed, Triton X-100 permeabilized A431 (human epidermoid carcinoma cell line) cells stained for LSR (green) using ab224237 at 4 µg/ml in ICC/IF.

  • Paraffin-embedded human stomach tissue stained for LSR using ab224237 at 1/50 dilution in immunohistochemical analysis.

  • Paraffin-embedded human placenta tissue stained for LSR using ab224237 at 1/50 dilution in immunohistochemical analysis.

  • Paraffin-embedded human endometrium tissue stained for LSR using ab224237 at 1/50 dilution in immunohistochemical analysis.

  • Paraffin-embedded human liver tissue stained for LSR using ab224237 at 1/50 dilution in immunohistochemical analysis.

  • Paraffin-embedded human testis tissue stained for LSR using ab224237 at 1/50 dilution in immunohistochemical analysis.

References

ab224237 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224237.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up