Overview

  • Product name

  • Description

    Rabbit polyclonal to LSR
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat
    Predicted to work with: Human
  • Immunogen

    Recombinant fragment corresponding to Mouse LSR aa 35-205. Two N-terminal tags, His-tag and GST-tag. (Expressed in E.coli).
    Sequence:

    SAIQVTVPDPYHVVILFQPVTLHCTYQMSNTLTAPIVIWKYKSFCRDRVA DAFSPASVDNQLNAQLAAGNPGYNPYVECQDSVRTVRVVATKQGNAVTLG DYYQGRRITITGNADLTFEQTAWGDSGVYYCSVVSAQDLDGNNEAYAELI VLGRTSEAPELLPGFRAGPLE


    Database link: Q99KG5

  • Positive control

    • IHC-P: Mouse heart, testis and cerebrum tissue. WB: Recombinant mouse LSR protein, rat and mouse liver tissue lysates and HepG2 whole cell lysate (ab7900). ICC/IF: HepG2 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab232780 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 66 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Probable role in the clearance of triglyceride-rich lipoprotein from blood. Binds chylomicrons, LDL and VLDL in presence of free fatty acids and allows their subsequent uptake in the cells.
  • Sequence similarities

    Belongs to the immunoglobulin superfamily. LISCH7 family.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • ILDR3 antibody
    • Immunoglobulin like domain containing receptor 3 antibody
    • Lipolysis Stimulated Lipoprotein Receptor antibody
    • Lipolysis stimulated remnant antibody
    • Lipolysis-stimulated lipoprotein receptor antibody
    • LISCH antibody
    • LISCH protein antibody
    • LISCH7 antibody
    • Liver specific bHLH Zip transcription factor antibody
    • LSR antibody
    • LSR_HUMAN antibody
    • MGC10659 antibody
    • MGC48312 antibody
    • MGC48503 antibody
    see all

Images

  • All lanes : Anti-LSR antibody (ab232780) at 3 µg/ml

    Lane 1 : Rat liver tissue lysate
    Lane 2 : Mouse liver tissue lysate
    Lane 3 : HepG2 (human liver hepatocellular carcinoma cell line) cell lysate

    Secondary
    All lanes : HRP-Linked Guinea pig Anti-Rabbit Ab at 1/2000 dilution

    Predicted band size: 66 kDa

  • HepG2 (human liver hepatocellular carcinoma cell line) cells stained for LSR using ab232780 at 20µg/mL in ICC/IF. FITC-labeled secondary antibody.

  • Formalin-fixed, paraffin-embedded mouse cerebrum tissue stained for LSR using ab232780 at 20µg/mL in immunohistochemical analysis. DAB staining.

  • Anti-LSR antibody (ab232780) at 2 µg/ml + Recombinant mouse LSR protein

    Predicted band size: 66 kDa

  • Formalin-fixed, paraffin-embedded mouse testis tissue stained for LSR using ab232780 at 20µg/mL in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded mouse heart tissue stained for LSR using ab232780 at 20 µg/mL in immunohistochemical analysis. DAB staining.

References

ab232780 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232780.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up