Overview

  • Product name

  • Description

    Rabbit polyclonal to LSS
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ELISAmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to Human LSS aa 2-51 (N terminal).
    Sequence:

    TEGTCLRRRGGPYKTEPATDLGRWRLNCERGRQTWTYLQDERAGREQTGL

  • Positive control

    • Fetal liver lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab80364 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 83 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay: 1:312500.

Target

Images

  • Anti-LSS antibody (ab80364) at 1 µg/ml (in 5% skim milk / PBS buffer) + human fetal liver lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 83 kDa
    Observed band size: 75 kDa
    why is the actual band size different from the predicted?

  • Anti-LSS antibody (ab80364) at 1/1000 dilution + lysate prepared from murine brain.

    Predicted band size: 83 kDa

References

This product has been referenced in:

  • Rodríguez-Penas D  et al. Aliskiren affects fatty-acid uptake and lipid-related genes in rodent and human cardiomyocytes. Biochem Pharmacol 82:491-504 (2011). WB ; Rat . Read more (PubMed: 21640714) »
See 1 Publication for this product

Customer reviews and Q&As

1-5 of 5 Abreviews or Q&A

Answer

Thank you for updating me about this.

I am very sorry that this replacement p53 antibody also did not work in your experiments. I am sorry for the inconvenience and would like to offer replacement with another p53 antibody such as ab32049 or offer full refund of this product. Please let me know how you would like to proceed regarding this antibody.

The results which you see with the LSS antibody are very interesting. From the control lane, we can see that the antibody is working. I am unsure why the bands in your sample are of lower molecular weight. It may be that, as you have mentioned, the brain tissue specific form may be smaller, but as I am not an expert on LSS I would recommend a literature search to confirm this suspicion.

I hope this information is helpful to you and look forward to your reply. Please do not hesitate to contact us if you need any more advice or information.

Read More

Answer

Thank you for confirming these details and for your cooperation. The details provided enable us to closely monitor the quality of our products. I am sorry this product did not perform as stated on the datasheet and for the inconvenience this has caused. As requested, I have issued a free of charge replacement with the order number xxxxx. Included in this order are positive control lysates for these products. To check the status of the order please contact our Customer Service team and reference this number. Please note that this free of charge replacement vial is also covered by our Abpromise guarantee. Should you still be experiencing difficulties, or if you have any further questions, please do not hesitate to let us know. I wish you the best of luck with your research.

Read More

Answer

Thank you for this added information.

I am very sorry that these products did not work as expected. After review of the protocols and sample preparation I can see no reason why the anti p53 would not work. As such I would be very happy to replace or refund this product for you.

Regarding the anti-LSS antibody. While the bands which you show are not at the expected weight, with the information we cannot rule out the bands present are not LSS. As such, if it is okay, I would like to send you a positive control to use with this product. Hopefully use of this control will help to determine whether what we are seeing are non-specific bands.

Further, Abcam currently is running a RabMAb promotion. Should you wish to receive a new vial of anti-p53 antibody we can also send to you, free of charge, any rabbit monoclonal antibody while stocks last. For more information please see https://www.abcam.com/index.html?pageconfig=resource&rid=15447


I look forward to hearing how you would like to proceed. Please do not hesitate to contact us if you need any more advice or information.

Read More

Answer

Thank you for this additional information.

I have a few further questions regarding your samples that I hope you might help me with. Could you please tell me what human cell line you are using? Also how are your samples processed for the western blots? Do you use a RIPA buffer or another buffer? Are the samples treated before collection?

Could you also provide the Abcam order confirmation number for these products? These products are covered by our Abpromise guarantee. We are happy to provide scientific support, replacement or refund should this product not perform as indicated on the datasheet. More information on our Abpromise may be found at the following link:

https://www.abcam.com/index.html?pageconfig=abpromise




I look forward to your reply. Please do not hesitate to contact us if you need any more advice or information.

Free Rabbit monoclonal antibody with any purchase of a primary antibody, while stocks last! Quote “RABMAB-XBSMG” in your next primary antibody order. For more information, visit the following link: https://www.abcam.com/index.html?pageconfig=resource&rid=15447

Read More

Answer

Thank you for contacting us.

I am very sorry to hear about the troubles which you have been help. In order to fully understand the problems could you please send me your protocols which you have used, sample preparation information, any troubleshooting steps you have taken and any images which you may have.

These products are covered by our Abpromise guarantee. We are happy provide scientific support at any time. If you are using the product in species and applications listed on the datasheet and contact us within six months of purchase, we are also happy to replace or refund the product should we not be able to help you to resolve the issue. More information on our Abpromise may be found at the following link:

https://www.abcam.com/index.html?pageconfig=abpromise

I hope that this information is helpful. Please let me know if you have any questions or there are other ways that Abcam may help you meet your research goals.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up