Overview

  • Product name

  • Description

    Rabbit polyclonal to LTA
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Mouse, Human
  • Immunogen

    Synthetic peptide within Human LTA aa 70-120 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    DPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKA Y


    Database link: P01374

  • Positive control

    • Rat medulla oblongata tissue.
  • General notes

     This product was previously labelled as TNF beta

     

Properties

Applications

Our Abpromise guarantee covers the use of ab203054 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Cytokine that in its homotrimeric form binds to TNFRSF1A/TNFR1, TNFRSF1B/TNFBR and TNFRSF14/HVEM. In its heterotrimeric form with LTB binds to TNFRSF3/LTBR. Lymphotoxin is produced by lymphocytes and cytotoxic for a wide range of tumor cells in vitro and in vivo.
  • Involvement in disease

    Genetic variations in LTA are a cause of susceptibility psoriatic arthritis (PSORAS) [MIM:607507]. PSORAS is an inflammatory, seronegative arthritis associated with psoriasis. It is a heterogeneous disorder ranging from a mild, non-destructive disease to a severe, progressive, erosive arthropathy. Five types of psoriatic arthritis have been defined: asymmetrical oligoarthritis characterized by primary involvement of the small joints of the fingers or toes; asymmetrical arthritis which involves the joints of the extremities; symmetrical polyarthritis characterized by a rheumatoidlike pattern that can involve hands, wrists, ankles, and feet; arthritis mutilans, which is a rare but deforming and destructive condition; arthritis of the sacroiliac joints and spine (psoriatic spondylitis).
  • Sequence similarities

    Belongs to the tumor necrosis factor family.
  • Cellular localization

    Secreted. Membrane. The homotrimer is secreted. The heterotrimer is membrane-associated.
  • Information by UniProt
  • Database links

  • Alternative names

    • LTalpha antibody
    • DAMA-25N12.13-004 antibody
    • DIF antibody
    • LT alpha antibody
    • LT antibody
    • LT-alpha antibody
    • Lta antibody
    • Lymphotoxin alpha (TNF superfamily, member 1) antibody
    • Lymphotoxin alpha antibody
    • Lymphotoxin-alpha antibody
    • MGC117668 antibody
    • OTTHUMP00000037612 antibody
    • OTTHUMP00000037613 antibody
    • TNF B antibody
    • TNF superfamily member 1 antibody
    • TNF, lymphocyte-derived antibody
    • TNF-beta antibody
    • TNFB antibody
    • TNFB_HUMAN antibody
    • TNFbeta antibody
    • TNFSF 1 antibody
    • TNFSF1 antibody
    • TNLG1E antibody
    • Tumor necrosis factor beta antibody
    • tumor necrosis factor ligand 1E antibody
    • Tumor necrosis factor ligand superfamily member 1 antibody
    • tumor necrosis factor superfamily member 1 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded rat medulla oblongata tissue labeling LTA with ab203054 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

ab203054 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab203054.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up