Overview

  • Product name

    Anti-LTB antibody - C-terminal
    See all LTB primary antibodies
  • Description

    Rabbit polyclonal to LTB - C-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Dog, Pig
  • Immunogen

    Synthetic peptide within Human LTB aa 175-224 (C terminal). The exact sequence is proprietary.
    Sequence:

    PELLLEGAETVTPVLDPARRQGYGPLWYTSVGFGGLVQLRRGERVYVNIS


    Database link: Q06643

  • Positive control

    • Human colorectal tumor lysate
  • General notes

     This product was previously labelled as Lymphotoxin Beta, Lymphotoxin Alpha + Beta

     

Properties

Applications

Our Abpromise guarantee covers the use of ab186479 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 25 kDa.

Target

  • Function

    Cytokine that binds to LTBR/TNFRSF3. May play a specific role in immune response regulation. Provides the membrane anchor for the attachment of the heterotrimeric complex to the cell surface. Isoform 2 is probably non-functional.
  • Tissue specificity

    Spleen and thymus.
  • Sequence similarities

    Belongs to the tumor necrosis factor family.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • LT beta antibody
    • LT-beta antibody
    • Ltb antibody
    • lymphotoxin beta antibody
    • Lymphotoxin-beta antibody
    • p33 antibody
    • TNF-C antibody
    • TNFC antibody
    • TNFC_HUMAN antibody
    • TNFSF3 antibody
    • Tumor necrosis factor C antibody
    • Tumor necrosis factor ligand superfamily member 3 antibody
    see all

Images

  • Anti-LTB antibody - C-terminal (ab186479) at 1 µg/ml + Human colorectal tumour lysate at 10 µg

    Predicted band size: 25 kDa

References

ab186479 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab186479.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up