Overview

  • Product name

    Anti-Luteinizing Hormone beta antibody
    See all Luteinizing Hormone beta primary antibodies
  • Description

    Sheep polyclonal to Luteinizing Hormone beta
  • Host species

    Sheep
  • Specificity

    TSH 20%; hCG6%; FSH6%; Prolactin hPL.
  • Tested applications

    Suitable for: ELISA, IHC-P, RIAmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Full length native protein (purified) corresponding to Human Luteinizing Hormone beta. Highly purified human pituitary luteinizing hormone.
    Sequence:

    SREPLRPWCHPINAILAVEKEGCPVCITVNTTICAGYCPTMMRVLQAVLP PLPQVVCTYR DVRFESIRLPGCPRGVDPVVSFPVALSCRCGPCRRSTS DCGGPKDHPLTCDHPQLSGLLF L


    Database link: P01229

  • Positive control

    • Human placenta tissue.

Properties

Associated products

Applications

Our Abpromise guarantee covers the use of ab189339 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ELISA Use at an assay dependent concentration.
IHC-P Use a concentration of 2.5 µg/ml. Perform heat mediated antigen retrieval before commencing with IHC staining protocol.
RIA Use at an assay dependent concentration.

Target

  • Function

    Promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids.
  • Tissue specificity

    Pituitary gland.
  • Involvement in disease

    Defects in LHB are a cause of hypogonadism LHB-related (HGON-LHB) [MIM:152780]. Hypogonadism is characterized by infertility and pseudohermaphroditism.
  • Sequence similarities

    Belongs to the glycoprotein hormones subunit beta family.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • CGB4 antibody
    • CHORIONIC GONADOTROPIN, BETA POLYPEPTIDE 4 antibody
    • hLHB antibody
    • Interstitial cell stimulating hormone beta chain antibody
    • Leutropin antibody
    • LH-B antibody
    • LHB antibody
    • LSH beta antibody
    • LSH-B antibody
    • LSH-beta antibody
    • LSHB antibody
    • LSHB_HUMAN antibody
    • Luteinizing hormone beta polypeptide antibody
    • Luteinizing hormone subunit beta antibody
    • Lutropin beta chain antibody
    • Lutropin subunit beta antibody
    see all

Images

  • Immunohistochemical analysis of formalin fixed paraffin embedded human placenta labeling Luteinizing Hormone beta with ab189339 at 2.5 µg/ml

References

ab189339 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab189339.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up