Anti-LXN/TCI antibody - N-terminal (ab224370)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-LXN/TCI antibody - N-terminal
See all LXN/TCI primary antibodies -
Description
Rabbit polyclonal to LXN/TCI - N-terminal -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, WB, IHC-Pmore details -
Species reactivity
Reacts with: Mouse, Rat, Human -
Immunogen
Recombinant fragment corresponding to Human LXN/TCI aa 1-106 (N terminal).
Sequence:MEIPPTNYPASRAALVAQNYINYQQGTPHRVFEVQKVKQASMEDIPGRGH KYHLKFAVEEIIQKQVKVNCTAEVLYPSTGQETAPEVNFTFEGETGKNPD EEDNTF
Database link: Q9BS40 -
Positive control
- IHC-P: Human prostate tissue. WB: MCF7, NIH/3T3 and NBT-II cell lysates. ICC/IF: MCF7 cells.
-
General notes
Protein previously labeled as LXN.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.2
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol, PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab224370 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ICC/IF | Use a concentration of 1 - 4 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
|
WB | 1/100 - 1/250. Predicted molecular weight: 26 kDa. | |
IHC-P | 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
Hardly reversible, non-competitive, and potent inhibitor of CPA1, CPA2 and CPA4. -
Tissue specificity
Highly expressed in heart, prostate, ovary, kidney, pancreas, and colon, moderate or low in other tissues including brain. -
Sequence similarities
Belongs to the protease inhibitor I47 (latexin) family. -
Cellular localization
Cytoplasm. - Information by UniProt
-
Database links
- Entrez Gene: 56925 Human
- Entrez Gene: 17035 Mouse
- Entrez Gene: 59073 Rat
- Omim: 609305 Human
- SwissProt: Q9BS40 Human
- SwissProt: P70202 Mouse
- SwissProt: Q64361 Rat
- Unigene: 478067 Human
see all -
Alternative names
- ECI antibody
- Endogenous carboxypeptidase inhibitor antibody
- Latexin antibody
see all
Images
-
Anti-LXN/TCI antibody - N-terminal (ab224370) at 1/100 dilution + MCF7 (human breast adenocarcinoma cell line) cell lysate
Developed using the ECL technique.
Predicted band size: 26 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-LXN/TCI antibody - N-terminal (ab224370)
Paraffin-embedded human prostate tissue stained for LXN/TCI using ab224370 at 1/200 dilution in immunohistochemical analysis.
-
All lanes : Anti-LXN/TCI antibody - N-terminal (ab224370) at 1/100 dilution
Lane 1 : NIH/3T3 (mouse embryonic fibroblast cell line) cell lysate
Lane 2 : NBT-II cell lysate
Developed using the ECL technique.
Predicted band size: 26 kDa -
PFA-fixed, Triton X-100 permeabilized MCF7 (human breast adenocarcinoma cell line) cells stained for LXN/TCI (green) using ab224370 at 4 µg/ml in ICC/IF.
Datasheets and documents
References
ab224370 has not yet been referenced specifically in any publications.