Overview

  • Product name

    Anti-LXN/TCI antibody - N-terminal
    See all LXN/TCI primary antibodies
  • Description

    Rabbit polyclonal to LXN/TCI - N-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human LXN/TCI aa 1-106 (N terminal).
    Sequence:

    MEIPPTNYPASRAALVAQNYINYQQGTPHRVFEVQKVKQASMEDIPGRGH KYHLKFAVEEIIQKQVKVNCTAEVLYPSTGQETAPEVNFTFEGETGKNPD EEDNTF


    Database link: Q9BS40

  • Positive control

    • IHC-P: Human prostate tissue. WB: MCF7, NIH/3T3 and NBT-II cell lysates. ICC/IF: MCF7 cells.
  • General notes

    Protein previously labeled as LXN.

Properties

Applications

Our Abpromise guarantee covers the use of ab224370 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

WB 1/100 - 1/250. Predicted molecular weight: 26 kDa.
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

Images

  • Anti-LXN/TCI antibody - N-terminal (ab224370) at 1/100 dilution + MCF7 (human breast adenocarcinoma cell line) cell lysate

    Developed using the ECL technique.

    Predicted band size: 26 kDa

  • Paraffin-embedded human prostate tissue stained for LXN/TCI using ab224370 at 1/200 dilution in immunohistochemical analysis.

  • All lanes : Anti-LXN/TCI antibody - N-terminal (ab224370) at 1/100 dilution

    Lane 1 : NIH/3T3 (mouse embryonic fibroblast cell line) cell lysate
    Lane 2 : NBT-II cell lysate

    Developed using the ECL technique.

    Predicted band size: 26 kDa

  • PFA-fixed, Triton X-100 permeabilized MCF7 (human breast adenocarcinoma cell line) cells stained for LXN/TCI (green) using ab224370 at 4 µg/ml in ICC/IF.

References

ab224370 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224370.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up