Anti-LXN/TCI antibody - N-terminal (ab224370)
Key features and details
- Rabbit polyclonal to LXN/TCI - N-terminal
- Suitable for: ICC/IF, WB, IHC-P
- Reacts with: Mouse, Rat, Human
- Isotype: IgG
Overview
-
Product name
Anti-LXN/TCI antibody - N-terminal
See all LXN/TCI primary antibodies -
Description
Rabbit polyclonal to LXN/TCI - N-terminal -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, WB, IHC-Pmore details -
Species reactivity
Reacts with: Mouse, Rat, Human -
Immunogen
Recombinant fragment corresponding to Human LXN/TCI aa 1-106 (N terminal).
Sequence:MEIPPTNYPASRAALVAQNYINYQQGTPHRVFEVQKVKQASMEDIPGRGH KYHLKFAVEEIIQKQVKVNCTAEVLYPSTGQETAPEVNFTFEGETGKNPD EEDNTF
Database link: Q9BS40 -
Positive control
- IHC-P: Human prostate tissue. WB: MCF7, NIH/3T3 and NBT-II cell lysates. ICC/IF: MCF7 cells.
-
General notes
Protein previously labeled as LXN.
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), PBS -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab224370 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| ICC/IF | Use a concentration of 0.25 - 2 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
|
| WB | Use a concentration of 0.04 - 0.4 µg/ml. Predicted molecular weight: 26 kDa. | |
| IHC-P | 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
Hardly reversible, non-competitive, and potent inhibitor of CPA1, CPA2 and CPA4. -
Tissue specificity
Highly expressed in heart, prostate, ovary, kidney, pancreas, and colon, moderate or low in other tissues including brain. -
Sequence similarities
Belongs to the protease inhibitor I47 (latexin) family. -
Cellular localization
Cytoplasm. - Information by UniProt
-
Database links
- Entrez Gene: 56925 Human
- Entrez Gene: 17035 Mouse
- Entrez Gene: 59073 Rat
- Omim: 609305 Human
- SwissProt: Q9BS40 Human
- SwissProt: P70202 Mouse
- SwissProt: Q64361 Rat
- Unigene: 478067 Human
see all -
Alternative names
- ECI antibody
- Endogenous carboxypeptidase inhibitor antibody
- Latexin antibody
see all
Images
-
Western blot - Anti-LXN/TCI antibody - N-terminal (ab224370)Anti-LXN/TCI antibody - N-terminal (ab224370) at 1/100 dilution + MCF7 (human breast adenocarcinoma cell line) cell lysate
Developed using the ECL technique.
Predicted band size: 26 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-LXN/TCI antibody - N-terminal (ab224370)Paraffin-embedded human prostate tissue stained for LXN/TCI using ab224370 at 1/200 dilution in immunohistochemical analysis.
-
Western blot - Anti-LXN/TCI antibody - N-terminal (ab224370)All lanes : Anti-LXN/TCI antibody - N-terminal (ab224370) at 1/100 dilution
Lane 1 : NIH/3T3 (mouse embryonic fibroblast cell line) cell lysate
Lane 2 : NBT-II cell lysate
Developed using the ECL technique.
Predicted band size: 26 kDa -
Immunocytochemistry/ Immunofluorescence - Anti-LXN/TCI antibody - N-terminal (ab224370)PFA-fixed, Triton X-100 permeabilized MCF7 (human breast adenocarcinoma cell line) cells stained for LXN/TCI (green) using ab224370 at 4 µg/ml in ICC/IF.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab224370 has not yet been referenced specifically in any publications.
