Overview

  • Product name
  • Description
    Rabbit polyclonal to LXR alpha
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Pig
    Predicted to work with: Human
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human LXR alpha aa 95-434. Two N-terminal tags. Expressed in E.coli.
    Sequence:

    NELCSVCGDKASGFHYNVLSCEGCKGFFRRSVIKGAHYICHSGGHCPMDT YMRRKCQECRLRKCRQAGMREECVLSEEQIRLKKLKRQEEEQAHATSLPP RASSPPQILPQLSPEQLGMIEKLVAAQQQCNRRSFSDRLRVTPWPMAPDP HSREARQQRFAHFTELAIVSVQEIVDFAKQLPGFLQLSREDQIALLKTSA IEVMLLETSRRYNPGSESITFLKDFSYNREDFAKAGLQVEFINPIFEFSR AMNELQLNDAEFALLIAISIFSADRPNVQDQLQVERLQHTYVEALHAYVS IHHPHDRLMFPRMLMKLVSLRTLSSVHSEQVFALRLQDKK


    Database link: Q13133-1

  • Positive control
    • WB: Recombinant human LXR alpha; Pig spleen tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab231942 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 - 5 µg/ml.

Target

  • Function
    Orphan receptor. Interaction with RXR shifts RXR from its role as a silent DNA-binding partner to an active ligand-binding subunit in mediating retinoid responses through target genes defined by LXRES. LXRES are DR4-type response elements characterized by direct repeats of two similar hexanuclotide half-sites spaced by four nucleotides. Plays an important role in the regulation of cholesterol homeostasis, regulating cholesterol uptake through MYLIP-dependent ubiquitination of LDLR, VLDLR and LRP8.
  • Tissue specificity
    Visceral organs specific expression. Strong expression was found in liver, kidney and intestine followed by spleen and to a lesser extent the adrenals.
  • Sequence similarities
    Belongs to the nuclear hormone receptor family. NR1 subfamily.
    Contains 1 nuclear receptor DNA-binding domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • Liver X receptor alpha antibody
    • LXR a antibody
    • LXRA antibody
    • NR1H3 antibody
    • NR1H3_HUMAN antibody
    • Nuclear receptor subfamily 1 group H member 3 antibody
    • Oxysterols receptor LXR alpha antibody
    • Oxysterols receptor LXR-alpha antibody
    • RLD 1 antibody
    • RLD1 antibody
    see all

Images

  • Anti-LXR alpha antibody (ab231942) at 3 µg/ml + Pig spleen tissue

    Secondary
    Guinea pig Anti-Rabbit Ab at 1/2000 dilution
  • Anti-LXR alpha antibody (ab231942) at 5 µg/ml + Recombinant human LXR alpha protein

References

ab231942 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231942.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up