Overview

  • Product name

    Anti-LXR beta/NER antibody
    See all LXR beta/NER primary antibodies
  • Description

    Rabbit polyclonal to LXR beta/NER
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IP, ChIP, ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Rat, Guinea pig, Dog
  • Immunogen

    Synthetic peptide corresponding to Human LXR beta/NER aa 37-86 (N terminal).
    Sequence:

    PWPGGPDPDVPGTDEASSACSTDWVIPDPEEEPERKRKKGPAPKMLGHEL

  • Positive control

    • Transfected 293T cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab56237 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IP Use at an assay dependent dilution. PubMed: 20951680
ChIP Use at an assay dependent dilution. PubMed: 20599735
ICC/IF Use at an assay dependent dilution.
WB Use a concentration of 1.25 µg/ml. Detects a band of approximately 56 kDa (predicted molecular weight: 51 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function

    Orphan receptor. Binds preferentially to double-stranded oligonucleotide direct repeats having the consensus half-site sequence 5'-AGGTCA-3' and 4-nt spacing (DR-4). Regulates cholesterol uptake through MYLIP-dependent ubiquitination of LDLR, VLDLR and LRP8.
  • Tissue specificity

    Ubiquitous.
  • Sequence similarities

    Belongs to the nuclear hormone receptor family. NR1 subfamily.
    Contains 1 nuclear receptor DNA-binding domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Liver X nuclear receptor beta antibody
    • Liver X receptor beta antibody
    • LX receptor beta antibody
    • LXR b antibody
    • LXR beta antibody
    • LXRB antibody
    • NER antibody
    • NER I antibody
    • NER1 antibody
    • NR1H 2 antibody
    • NR1H2 antibody
    • NR1H2_HUMAN antibody
    • Nuclear orphan receptor LXR beta antibody
    • Nuclear receptor NER antibody
    • Nuclear receptor subfamily 1 group H member 2 antibody
    • OR-1 antibody
    • Oxysterols receptor LXR-beta antibody
    • RIP15 antibody
    • Steroid hormone nuclear receptor NER antibody
    • Ubiquitously-expressed nuclear receptor antibody
    • UNR antibody
    see all

Images

  • Anti-LXR beta/NER antibody (ab56237) at 1.25 µg/ml + Transfected 293T cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 51 kDa
    Observed band size: 56 kDa
    why is the actual band size different from the predicted?



    Gel concentration: 12%

References

This product has been referenced in:

  • Fang F  et al. Expression of NR1H3 in endometrial carcinoma and its effect on the proliferation of Ishikawa cells in vitro. Onco Targets Ther 12:685-697 (2019). Read more (PubMed: 30705597) »
  • Tristán-Flores FE  et al. Liver X Receptor-Binding DNA Motif Associated With Atherosclerosis-Specific DNA Methylation Profiles of Alu Elements and Neighboring CpG Islands. J Am Heart Assoc 7:N/A (2018). Read more (PubMed: 29386205) »
See all 11 Publications for this product

Customer reviews and Q&As

1-2 of 2 Abreviews or Q&A

Answer

Thank you for your enquiry and your interest in our products.

We have several antibodies against LXR beta (ab24361, ab56237, ab58089, ab58092, ab76983, ab106473) . The tested application/species/unit size can be found on the on-line product datasheets. I would advise you to take a look at these document to see which product would suit you need best.

If you need any further assistance in the future, please do not hesitate to contact me.

Regarding shipment and packaging information, could you please contact our authorized distributor in India for further details.

NuLife Consultants & Distributors (Pvt.) Ltd.
NuLife Consultants & Distributors (Pvt.) Ltd.
M-52, First Floor,
Lajpat Nagar- Part-II,
New Delhi-110024-India
Tel 011-46112691/ 46112692/ 29836141

Website http://www.nulife.in/

Fax 91 - 011-46586216 Email mailto:nulife@bol.net.inand mailto:sales@nulife.in

I hope this helps and if I can assist further, please do not hesitate to contact me.

Read More
Application
Immunocytochemistry/ Immunofluorescence
Sample
Hamster Cell (CHO K1 cells expressing Human LXR beta)
Specification
CHO K1 cells expressing Human LXR beta
Fixative
Formaldehyde
Blocking step
TBS + 3% Dried Milk + 0.1 % Triton X-100 as blocking agent for 20 minute(s) · Concentration: 3% · Temperature: 22°C

Abcam user community

Verified customer

Submitted Jul 30 2008

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up