Overview

  • Product name

  • Description

    Rabbit polyclonal to Ly-6K
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Ly-6K aa 34-138.
    Sequence:

    TDEGDNRVWCHVCERENTFECQNPRRCKWTEPYCVIAAVKIFPRFFMVAK QCSAGCAAMERPKPEEKRFLLEEPMPFFYLKCCKIRYCNLEGPPINSSVF KEYAG


    Database link: Q17RY6

  • Positive control

    • IHC-P: Human testis tissue.
  • General notes

    Previously labelled as Lymphocyte Antigen 6 Complex. 

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224402 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance

    The Lymphocyte Antigen 6 Complex is a 15 kDa phosphatidyl inositol anchored molecule, attached to the cell membrane by a GPI-anchor. The Lymphocyte Antigen 6 Complex is present on most immature T cells of the thymus, on lymphoid cells in bone marrow and peripheral B cells, but absent on peripheral T cells.
  • Cellular localization

    Cell Membrane
  • Database links

  • Alternative names

    • Lymphocyte antigen Ly-6K antibody
    • 2410015A16Rik antibody
    • 3110035B01Rik antibody
    • CT97 antibody
    • FLJ35226 antibody
    • HSJ001348 antibody
    • ly 6K antibody
    • Lymphocyte Antigen 6 Complex antibody
    • Lymphocyte antigen 6 complex, locus K antibody
    • mLy 6K antibody
    • ThB antibody
    • Thymocyte B cell antigen antibody
    see all

Images

  • Paraffin-embedded human testis tissue stained for Ly-6K using ab224402 at 1/500 dilution in immunohistochemical analysis.

References

ab224402 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224402.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up