Overview

  • Product name

    Anti-Ly-6K antibody [CL2433]
    See all Ly-6K primary antibodies
  • Description

    Mouse monoclonal [CL2433] to Ly-6K
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Ly-6K aa 34-138.
    Sequence:

    TDEGDNRVWCHVCERENTFECQNPRRCKWTEPYCVIAAVKIFPRFFMVAK QCSAGCAAMERPKPEEKRFLLEEPMPFFYLKCCKIRYCNLEGPPINSSVF KEYAG


    Database link: Q17RY6

  • Epitope

    Binds to an epitope located within the peptide sequence LEEPMPFFYLKCCKI (104-118 aa) as determined by overlapping synthetic peptides.
  • Positive control

    • Human testis tissue lysate; Human testis tissue.
  • General notes

    Previously labelled as Lymphocyte Antigen 6 Complex. 

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, 59% PBS
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Monoclonal
  • Clone number

    CL2433
  • Isotype

    IgG1
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab211873 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/100 - 1/250. Predicted molecular weight: 25 kDa.

Target

  • Relevance

    The Lymphocyte Antigen 6 Complex is a 15 kDa phosphatidyl inositol anchored molecule, attached to the cell membrane by a GPI-anchor. The Lymphocyte Antigen 6 Complex is present on most immature T cells of the thymus, on lymphoid cells in bone marrow and peripheral B cells, but absent on peripheral T cells.
  • Cellular localization

    Cell Membrane
  • Database links

  • Alternative names

    • Lymphocyte antigen Ly-6K antibody
    • 2410015A16Rik antibody
    • 3110035B01Rik antibody
    • CT97 antibody
    • FLJ35226 antibody
    • HSJ001348 antibody
    • ly 6K antibody
    • Lymphocyte Antigen 6 Complex antibody
    • Lymphocyte antigen 6 complex, locus K antibody
    • mLy 6K antibody
    • ThB antibody
    • Thymocyte B cell antigen antibody
    see all

Images

  • Anti-Ly-6K antibody [CL2433] (ab211873) at 1/100 dilution + Human testis tissue lysate

    Predicted band size: 25 kDa

  • Immunohistochemical analysis of paraffin-embedded, formalin fixed Human testis tissue labeling Ly-6K with ab211873 at 1/200 dilution.

  • Negative control: Immunohistochemical analysis of paraffin-embedded, formalin fixed Human liver tissue labeling Ly-6K with ab211873 at 1/200 dilution showing absence of staining.

References

ab211873 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab211873.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up