Anti-LY6E/SCA-2 antibody (ab172021)
Key features and details
- Rabbit polyclonal to LY6E/SCA-2
- Suitable for: WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-LY6E/SCA-2 antibody
See all LY6E/SCA-2 primary antibodies -
Description
Rabbit polyclonal to LY6E/SCA-2 -
Host species
Rabbit -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant full length protein corresponding to Human LY6E/SCA-2 aa 1-131. (NP_002337.1)
Sequence:MKIFLPVLLAALLGVERASSLMCFSCLNQKSNLYCLKPTICSDQDNYCVT VSASAGIGNLVTFGHSLSKTCSPACPIPEGVNVGVASMGISCCQSFLCNF SAADGGLRASVTLLGAGLLLSLLPALLRFGP
Database link: Q16553 -
Positive control
- WB: LY6E/SCA-2 transfected lysate.
-
General notes
Protein previously known as LY6E.
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.4
Constituent: 100% PBS -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab172021 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB |
Use a concentration of 1 µg/ml. Predicted molecular weight: 14 kDa.
|
Notes |
---|
WB
Use a concentration of 1 µg/ml. Predicted molecular weight: 14 kDa. |
Target
-
Database links
- Entrez Gene: 4061 Human
- SwissProt: Q16553 Human
- Unigene: 521903 Human
-
Alternative names
- Ly-6E antibody
- Retinoic acid-induced gene E protein antibody
- RIG-E antibody
see all
Images
-
All lanes : Anti-LY6E/SCA-2 antibody (ab172021) at 1 µg/ml
Lane 1 : LY6E/SCA-2 transfected lysate
Lane 2 : Non-transfected lysate
Lysates/proteins at 15 µl per lane.
Secondary
All lanes : Goat Anti-Rabbit IgG (H+L), Peroxidase Conjugated at 1/7500 dilution
Predicted band size: 14 kDa
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab172021 has not yet been referenced specifically in any publications.