Overview

  • Product name

  • Description

    Rabbit polyclonal to LY6E/SCA-2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide within Human LY6E/SCA-2 aa 26-71. The exact sequence is proprietary.
    Sequence:

    CLNQKSNLYCLKPTICSDQDNYCVTVSASAGIGNLVTFGHSLSKTC


    Database link: Q16553

  • Positive control

    • WB: HEK-293T, Raw264.7 and H9C2 whole cell lysate.
  • General notes

    Protein previously known as LY6E.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.05% Sodium azide
    Constituent: PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Purity is > 95% by SDS-PAGE.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab201098 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 13 kDa.Can be blocked with Recombinant Human LY6E/SCA-2 protein (Tagged) (ab158836).

Target

Images

  • All lanes : Anti-LY6E/SCA-2 antibody (ab201098)

    Lane 1 : HEK-293T whole cell lysate
    Lane 2 : Raw264.7 whole cell lysate
    Lane 3 : H9C2 whole cell lysate

    Predicted band size: 13 kDa

References

ab201098 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

1-2 of 2 Abreviews or Q&A

Application
Western blot
Sample
Human Cell lysate - whole cell (control, LY6E, mouse Ly6e expressing fibroblasts)
Gel Running Conditions
Reduced Denaturing (10)
Loading amount
20 µg
Specification
control, LY6E, mouse Ly6e expressing fibroblasts
Blocking step
Milk as blocking agent for 24 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 4°C

Abcam user community

Verified customer

Submitted Mar 18 2016

Application
Flow Cytometry
Sample
Human Cell (Ectopically expressed LY6E, control, mouse Ly6e in)
Permeabilization
No
Gating Strategy
Live->Singlets->Lentivirus-expressing
Specification
Ectopically expressed LY6E, control, mouse Ly6e in
Fixation
Paraformaldehyde

Abcam user community

Verified customer

Submitted Mar 04 2016

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up