Overview

  • Product name

    Anti-LY75/DEC-205 antibody
    See all LY75/DEC-205 primary antibodies
  • Description

    Rabbit polyclonal to LY75/DEC-205
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human LY75/DEC-205 aa 440-680.
    Sequence:

    TEVTLTYWDENEPNVPYNKTPNCVSYLGELGQWKVQSCEEKLKYVCKRKG EKLNDASSDKMCPPDEGWKRHGETCYKIYEDEVPFGTNCNLTITSRFEQE YLNDLMKKYDKSLRKYFWTGLRDVDSCGEYNWATVGGRRRAVTFSNWNFL EPASPGGCVAMSTGKSVGKWEVKDCRSFKALSICKKMSGPLGPEEASPKP DDPCPEGWQSFPASLSCYKVFHAERIVRKRNWEEAERFCQA


    Database link: O60449

  • Positive control

    • WB: Mouse liver tissue lysate. IHC-P: Human tonsil and spleen tissue.
  • General notes

    Previously labelled as LY75. 

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab230251 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/1000 - 1/5000. Detects a band of approximately 198 kDa (predicted molecular weight: 216, 210, 198, 20 kDa).

Target

  • Function

    Acts as an endocytic receptor to direct captured antigens from the extracellular space to a specialized antigen-processing compartment (By similarity). Causes reduced proliferation of B-lymphocytes.
  • Tissue specificity

    Expressed in spleen, thymus, colon and peripheral blood lymphocytes. Detected in myeloid and B lymphoid cell lines. Isoform 2 and isoform 3 are expressed in malignant Hodgkin lymphoma cells called Hodgkin and Reed-Sternberg (HRS) cells.
  • Sequence similarities

    Contains 10 C-type lectin domains.
    Contains 1 fibronectin type-II domain.
    Contains 1 ricin B-type lectin domain.
  • Post-translational
    modifications

    N-glycosylated.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • C-type lectin domain family 13 member B antibody
    • CD 205 antibody
    • CD205 antibody
    • CD205 antigen antibody
    • CLEC 13B antibody
    • CLEC13B antibody
    • DEC 205 antibody
    • DEC-205 antibody
    • DEC205 antibody
    • gp200 antibody
    • gp200 MR6 antibody
    • gp200-MR6 antibody
    • LY 75 antibody
    • Ly-75 antibody
    • LY75 antibody
    • LY75_HUMAN antibody
    • Lymphocyte antigen 75 antibody
    • Renal Cell Carcinoma (gp200) antibody
    see all

Images

  • Anti-LY75/DEC-205 antibody (ab230251) at 1/1000 dilution + Mouse liver tissue lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 216, 210, 198, 20 kDa
    Observed band size: 198 kDa
    why is the actual band size different from the predicted?

  • Paraffin-embedded human tonsil tissue stained for LY75/DEC-205 with ab230251 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human spleen tissue stained for LY75/DEC-205 with ab230251 at 1/100 dilution in immunohistochemical analysis.

References

ab230251 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230251.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up