Overview

  • Product name

  • Description

    Rabbit polyclonal to LYAR
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Mouse LYAR aa 270-388. Two N-terminal tags. (Expressed in E.coli).
    Sequence:

    GQTKTAAGKRKRPKHSGAESGYKKKKMKLPEQPEEGEAKDHEAPSKGKFN WKGTIKAVLKQAPDNEISVKKLKKKVIAQYHAVMNDHHTSEEELLAIFNR KISRNPTFKVLKDRVKLLK


    Database link: Q08288

  • Positive control

    • WB: Recombinant mouse LYAR protein; Mouse placenta and testis, lysate; Rat testis lysate; A431 cell lysate. IHC-P: Mouse testis tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab233082 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

Images

  • Formalin-fixed, paraffin-embedded mouse testis tissue stained for LYAR using ab233082 at 20 µg/mL in immunohistochemical analysis. DAB staining.

  • Anti-LYAR antibody (ab233082) at 3 µg/ml + A431 (human epidermoid carcinoma cell line) cell lysate

    Secondary
    HRP-Linked Goat anti-Rabbit IgG polyclonal at 0.2 µg/ml
  • Anti-LYAR antibody (ab233082) at 3 µg/ml + Rat testis tissue lysate

    Secondary
    HRP-Linked Goat anti-Rabbit IgG polyclonal at 0.2 µg/ml
  • Anti-LYAR antibody (ab233082) at 3 µg/ml + Mouse testis tissue lysate

    Secondary
    HRP-Linked Goat anti-Rabbit IgG polyclonal at 0.2 µg/ml
  • Anti-LYAR antibody (ab233082) at 3 µg/ml + Mouse placenta tissue lysate

    Secondary
    HRP-Linked Goat anti-Rabbit IgG polyclonal at 0.2 µg/ml
  • Anti-LYAR antibody (ab233082) at 2 µg/ml + Recombinant mouse LYAR protein

References

ab233082 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233082.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up