Overview

  • Product name

  • Description

    Rabbit polyclonal to LYAR
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human LYAR aa 1-379.
    Sequence:

    MVFFTCNACGESVKKIQVEKHVSVCRNCECLSCIDCGKDFWGDDYKNHVK CISEDQKYGGKGYEGKTHKGDIKQQAWIQKISELIKRPNVSPKVRELLEQ ISAFDNVPRKKAKFQNWMKNSLKVHNESILDQVWNIFSEASNSEPVNKEQ DQRPLHPVANPHAEISTKVPASKVKDAVEQQGEVKKNKRERKEERQKKRK REKKELKLENHQENSRNQKPKKRKKGQEADLEAGGEEVPEANGSAGKRSK KKKQRKDSASEEEAHVGAGKRKRRHSEVETDSKKKKMKLPEHPEGGEPED DEAPAKGKFNWKGTIKAILKQAPDNEITIKKLRKKVLAQYYTVTDEHHRS EEELLVIFNKKISKNPTFKLLKDKVKLVK


    Database link: Q9NX58

  • Positive control

    • WB: K562, HeLa, SH-SY5Y and PC-3 whole cell lysate. IHC-P: Human testis tissue. ICC/IF: HeLa cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity greater than 95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab237738 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/500.
IHC-P 1/500 - 1/1000.
WB 1/500 - 1/5000. Predicted molecular weight: 44 kDa.

Target

  • Sequence similarities

    Contains 2 C2HC-type zinc fingers.
  • Cellular localization

    Nucleus > nucleolus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Cell growth regulating nucleolar protein antibody
    • Cell growth-regulating nucleolar protein antibody
    • Likely ortholog of mouse Ly1 antibody reactive clone antibody
    • Ly1 antibody reactive antibody
    • Ly1 antibody reactive homolog (mouse) antibody
    • Ly1 antibody reactive homolog antibody
    • LYAR antibody
    • LYAR_HUMAN antibody
    • ZC2HC2 antibody
    • ZLYAR antibody
    see all

Images

  • All lanes : Anti-LYAR antibody (ab237738) at 1/500 dilution

    Lane 1 : K562 (human chronic myelogenous leukemia cell line from bone marrow ) whole cell lysate
    Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 3 : SH-SY5Y (human neuroblastoma cell line from bone marrow) whole cell lysate
    Lane 4 : PC-3 (human prostate adenocarcinoma cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 44 kDa

  • Paraffin-embedded human testis tissue stained for LYAR using ab237738 at 1/500 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30min at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized tissue using an HRP conjugated SP system.

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for LYAR (green) using ab237738 at 1/166 dilution in ICC/IF, followed by Alexa Fluor® 488-congugated Goat Anti-Rabbit IgG (H+L) secondary antibody.

    The cells were fixed in 4% formaldehyde, permeabilized tissue using 0.2% Triton X-100 and blocked in 10% normal Goat Serum. The cells were then incubated with the antibody overnight at 4°C. Counterstained with DAPI.

References

ab237738 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab237738.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up