Overview

  • Product name
    Anti-LYPD1 / PHTS antibody
  • Description
    Rabbit polyclonal to LYPD1 / PHTS
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human LYPD1/ PHTS aa 22-71. (BC017318)
    Sequence:

    QIQCYQCEEFQLNNDCSSPEFIVNCTVNVQDMCQKEVMEQSAGIMYRKSC

  • Positive control
    • Mouse kidney lysate; Human fetal kidney tissue.
  • General notes

    Previously labelled as LYPD1.

Properties

Applications

Our Abpromise guarantee covers the use of ab157516 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1000. Predicted molecular weight: 15 kDa.
IHC-P 1/100 - 1/500.

Target

Images

  • Anti-LYPD1 / PHTS antibody (ab157516) at 1/500 dilution + Mouse kidney lysate

    Predicted band size: 15 kDa

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human fetal kidney tissue labeling LYPD1 / PHTS with ab157516 at 1/100 dilution.

References

This product has been referenced in:
  • Masuda S  et al. Inhibition of LYPD1 is critical for endothelial network formation in bioengineered tissue with human cardiac fibroblasts. Biomaterials 166:109-121 (2018). WB ; African green monkey . Read more (PubMed: 29550615) »
See 1 Publication for this product

Customer reviews and Q&As

Application
Western blot
Sample
Mouse Purified protein (Amygdala containing brain extract)
Gel Running Conditions
Reduced Denaturing (4-20% SDS PAGE)
Loading amount
40 µg
Specification
Amygdala containing brain extract
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 4°C

Abcam user community

Verified customer

Submitted Jul 03 2018

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up