For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    lypd1phts-antibody-ab157516.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Cell Biology Cell Cycle Cell Cycle Inhibitors p53
Share by email

Anti-LYPD1/PHTS antibody (ab157516)

  • Datasheet
  • SDS
Reviews (1) Submit a question References (3)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Western blot - Anti-LYPD1/PHTS antibody (ab157516)

    Key features and details

    • Rabbit polyclonal to LYPD1/PHTS
    • Suitable for: WB
    • Reacts with: Mouse
    • Isotype: IgG

    You may also be interested in

    Secondary
    Product image
    Goat Anti-Rabbit IgG H&L (HRP) (ab205718)

    View more associated products

    Overview

    • Product name

      Anti-LYPD1/PHTS antibody
    • Description

      Rabbit polyclonal to LYPD1/PHTS
    • Host species

      Rabbit
    • Tested applications

      Suitable for: WBmore details
    • Species reactivity

      Reacts with: Mouse
    • Immunogen

      Recombinant fragment corresponding to Human LYPD1/PHTS aa 22-71. (BC017318)
      Sequence:

      QIQCYQCEEFQLNNDCSSPEFIVNCTVNVQDMCQKEVMEQSAGIMYRKSC

      Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
    • Positive control

      • Mouse kidney lysate
    • General notes

      Previously labelled as LYPD1.

      The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.

      If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As

    Properties

    • Form

      Lyophilized:Reconstitute in 200ul Sterile Distilled Water.
    • Storage instructions

      Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
    • Storage buffer

      pH: 7.20
      Preservative: 0.02% Sodium azide
      Constituents: 1% BSA, 98% PBS
    • Concentration information loading...
    • Purity

      Immunogen affinity purified
    • Clonality

      Polyclonal
    • Isotype

      IgG
    • Research areas

      • Cell Biology
      • Cell Cycle
      • Cell Cycle Inhibitors
      • p53
      • Cell Biology
      • Apoptosis
      • Intracellular
      • p53 Pathway
      • Epigenetics and Nuclear Signaling
      • DNA / RNA
      • DNA Damage & Repair
      • DNA Damage Response
      • p53
      • Cancer
      • Cell cycle
      • Cell cycle inhibitors
      • p53 pathway

    Associated products

    • Compatible Secondaries

      • Goat Anti-Rabbit IgG H&L (Alexa Fluor® 488) (ab150077)
      • Goat Anti-Rabbit IgG H&L (HRP) (ab205718)
    • Isotype control

      • Rabbit IgG, polyclonal - Isotype Control (ChIP Grade) (ab171870)
    • Positive Controls

      • Mouse kidney normal tissue lysate - total protein (ab29305)

    Applications

    The Abpromise guarantee

    Our Abpromise guarantee covers the use of ab157516 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    Application Abreviews Notes
    WB (1)
    1/500 - 1/1000. Predicted molecular weight: 15 kDa.
    Notes
    WB
    1/500 - 1/1000. Predicted molecular weight: 15 kDa.

    Target

    • Sequence similarities

      Contains 1 UPAR/Ly6 domain.
    • Cellular localization

      Cell membrane.
    • Target information above from: UniProt accession Q8N2G4 The UniProt Consortium
      The Universal Protein Resource (UniProt) in 2010
      Nucleic Acids Res. 38:D142-D148 (2010) .

      Information by UniProt
    • Database links

      • Entrez Gene: 72585 Mouse
      • SwissProt: Q8BLC3 Mouse
      • Unigene: 490405 Mouse
      • Alternative names

        • FLJ41033 antibody
        • LY6/PLAUR domain containing 1 antibody
        • Ly6/PLAUR domain-containing protein 1 antibody
        • Lypd1 antibody
        • LYPD1_HUMAN antibody
        • LYPDC1 antibody
        • MGC29643 antibody
        • PHTS antibody
        • Putative HeLa tumor suppressor antibody
        see all

      Images

      • Western blot - Anti-LYPD1/PHTS antibody (ab157516)
        Western blot - Anti-LYPD1/PHTS antibody (ab157516)
        Anti-LYPD1/PHTS antibody (ab157516) at 1/500 dilution + Mouse kidney lysate

        Predicted band size: 15 kDa

      Protocols

      • Western blot protocols
      • Immunohistochemistry protocols

      Click here to view the general protocols

      Datasheets and documents

      • SDS download

      • Datasheet download

        Download

      References (3)

      Publishing research using ab157516? Please let us know so that we can cite the reference in this datasheet.

      ab157516 has been referenced in 3 publications.

      • Sakamoto S  et al. Heart-derived fibroblasts express LYPD-1 and negatively regulate angiogenesis in rat. Regen Ther 15:27-33 (2020). PubMed: 32514414
      • Yang L  et al. Transcriptomic Landscape of von Economo Neurons in Human Anterior Cingulate Cortex Revealed by Microdissected-Cell RNA Sequencing. Cereb Cortex 29:838-851 (2019). PubMed: 30535007
      • Masuda S  et al. Inhibition of LYPD1 is critical for endothelial network formation in bioengineered tissue with human cardiac fibroblasts. Biomaterials 166:109-121 (2018). WB ; African green monkey . PubMed: 29550615

      Customer reviews and Q&As

      Show All Reviews Q&A
      Submit a review Submit a question

      Western blot abreview for Anti-LYPD1/PHTS antibody

      Excellent
      Abreviews
      Abreviews
      abreview image
      Application
      Western blot
      Sample
      Mouse Purified protein (Amygdala containing brain extract)
      Gel Running Conditions
      Reduced Denaturing (4-20% SDS PAGE)
      Loading amount
      40 µg
      Specification
      Amygdala containing brain extract
      Blocking step
      Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 4°C
      Read More

      Abcam user community

      Verified customer

      Submitted Jul 03 2018

      Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
      For licensing inquiries, please contact partnerships@abcam.com

      Get resources and offers direct to your inbox Sign up
      A-Z by research area
      • Cancer
      • Cardiovascular
      • Cell biology
      • Developmental biology
      • Epigenetics & Nuclear signaling
      • Immunology
      • Metabolism
      • Microbiology
      • Neuroscience
      • Signal transduction
      • Stem cells
      A-Z by product type
      • Primary antibodies
      • Secondary antibodies
      • Biochemicals
      • Isotype controls
      • Flow cytometry multi-color selector
      • Kits
      • Loading controls
      • Lysates
      • Peptides
      • Proteins
      • Slides
      • Tags and cell markers
      • Tools & Reagents
      Help & support
      • Support
      • Make an Inquiry
      • Protocols & troubleshooting
      • Placing an order
      • RabMAb products
      • Biochemical product FAQs
      • Training
      • Browse by Target
      Company
      • Corporate site
      • Investor relations
      • Company news
      • Careers
      • About us
      • Blog
      Events
      • Tradeshows
      • Conferences
      International websites
      • abcam.cn
      • abcam.co.jp

      Join with us

      • LinkedIn
      • facebook
      • Twitter
      • YouTube
      • Terms of sale
      • Website terms of use
      • Cookie policy
      • Privacy policy
      • Legal
      • Modern slavery statement
      © 1998-2021 Abcam plc. All rights reserved.