Anti-LYPD1/PHTS antibody (ab157516)
Key features and details
- Rabbit polyclonal to LYPD1/PHTS
- Suitable for: WB
- Reacts with: Mouse
- Isotype: IgG
Overview
-
Product name
Anti-LYPD1/PHTS antibody -
Description
Rabbit polyclonal to LYPD1/PHTS -
Host species
Rabbit -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Mouse -
Immunogen
Recombinant fragment corresponding to Human LYPD1/PHTS aa 22-71. (BC017318)
Sequence:QIQCYQCEEFQLNNDCSSPEFIVNCTVNVQDMCQKEVMEQSAGIMYRKSC
-
Positive control
- Mouse kidney lysate
-
General notes
Previously labelled as LYPD1.
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Lyophilized:Reconstitute in 200ul Sterile Distilled Water. -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 1% BSA, 98% PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab157516 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | (1) |
1/500 - 1/1000. Predicted molecular weight: 15 kDa.
|
Notes |
---|
WB
1/500 - 1/1000. Predicted molecular weight: 15 kDa. |
Target
-
Sequence similarities
Contains 1 UPAR/Ly6 domain. -
Cellular localization
Cell membrane. - Information by UniProt
-
Database links
- Entrez Gene: 72585 Mouse
- SwissProt: Q8BLC3 Mouse
- Unigene: 490405 Mouse
-
Alternative names
- FLJ41033 antibody
- LY6/PLAUR domain containing 1 antibody
- Ly6/PLAUR domain-containing protein 1 antibody
see all
Images
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (3)
ab157516 has been referenced in 3 publications.
- Sakamoto S et al. Heart-derived fibroblasts express LYPD-1 and negatively regulate angiogenesis in rat. Regen Ther 15:27-33 (2020). PubMed: 32514414
- Yang L et al. Transcriptomic Landscape of von Economo Neurons in Human Anterior Cingulate Cortex Revealed by Microdissected-Cell RNA Sequencing. Cereb Cortex 29:838-851 (2019). PubMed: 30535007
- Masuda S et al. Inhibition of LYPD1 is critical for endothelial network formation in bioengineered tissue with human cardiac fibroblasts. Biomaterials 166:109-121 (2018). WB ; African green monkey . PubMed: 29550615