Overview

  • Product name

    Anti-LYSMD2 antibody
  • Description

    Rabbit polyclonal to LYSMD2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human LYSMD2 aa 113-213.
    Sequence:

    LNIPVISEKPLLFNGLNSIDSPENETADNSFSQEEEPVVAGEDLPPPSPQ ESDVQPVQPEEVSARDFLQRLDLQIKLSTQAAKKLKEESRDEESPYATSL Y


    Database link: Q8IV50

  • Positive control

    • IHC-P: Human caudate tissue. ICC/IF: A431 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab243545 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance

    LYSMD2 contains 1 LysM repeat and its exact function is still unclear. Two isoforms have been identified.
  • Database links

  • Alternative names

    • DKFZp686I2243 antibody
    • LysM and putative peptidoglycan binding domain containing protein 2 antibody
    • LysM, putative peptidoglycan-binding, domain containing 2 antibody
    • MGC35274 antibody

Images

  • Paraffin-embedded human caudate tissue stained for LYSMD2 using ab243545 at 1/500 dilution in immunohistochemical analysis.

  • PFA-fixed, Triton X-100 permeabilized A431 (human epidermoid carcinoma cell line) cells stained for LYSMD2 (green) using ab243545 at 4 µg/ml in ICC/IF analysis. Microtubules are labeled in red.

References

ab243545 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab243545.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up