Overview

  • Product name

    Anti-Lysophospholipase 1/LPL-I antibody
    See all Lysophospholipase 1/LPL-I primary antibodies
  • Description

    Mouse polyclonal to Lysophospholipase 1/LPL-I
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Cow, Orangutan
  • Immunogen

    Full length protein corresponding to Human Lysophospholipase 1/LPL-I aa 1-230. UniProt ID: O75608
    Sequence:

    MCGNNMSTPLPAIVPAARKATAAVIFLHGLGDTGHGWAEAFAGIRSSHIK YICPHAPVRPVTLNMNVAMPSWFDIIGLSPDSQEDESGIKQAAENIKALI DQEVKNGIPSNRIILGGFSQGGALSLYTALTTQQKLAGVTALSCWLPLRA SFPQGPIGGANRDISILQCHGDCDPLVPLMFGSLTVEKLKTLVNPANVTF KTYEGMMHSSCQQEMMDVKQFIDKLLPPID


    Database link: NP_006321.1

  • Positive control

    • Recombinant Human Lysophospholipase 1/LPL-I protein (ab151829) can be used as a positive control in WB. Lysophospholipase 1/LPL-I-transfected 293T cell lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term.
  • Storage buffer

    pH: 7.20
    Constituent: 99% PBS
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab168773 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 25 kDa.

Target

Images

  • All lanes : Anti-Lysophospholipase 1/LPL-I antibody (ab168773) at 1 µg/ml

    Lane 1 : Lysophospholipase 1/LPL-I-transfected 293T cell lysate
    Lane 2 : Non-transfected 293T cell lysate

    Lysates/proteins at 15 µl per lane.

    Developed using the ECL technique.

    Predicted band size: 25 kDa

References

ab168773 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab168773.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up