Overview

  • Product name

    Anti-Lysosomal acid lipase/LAL antibody
    See all Lysosomal acid lipase/LAL primary antibodies
  • Description

    Rabbit polyclonal to Lysosomal acid lipase/LAL
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Cynomolgus monkey
  • Immunogen

    Recombinant full length protein corresponding to Human Lysosomal acid lipase/LAL aa 22-399.
    Sequence:

    SGGKLTAVDPETNMNVSEIISYWGFPSEEYLVETEDGYILCLNRIPHGRK NHSDKGPKPVVFLQHGLLADSSNWVTNLANSSLGFILADAGFDVWMGNSR GNTWSRKHKTLSVSQDEFWAFSYDEMAKYDLPASINFILNKTGQEQVYYV GHSQGTTIGFIAFSQIPELAKRIKMFFALGPVASVAFCTSPMAKLGRLPD HLIKDLFGDKEFLPQSAFLKWLGTHVCTHVILKELCGNLCFLLCGFNERN LNMSRVDVYTTHSPAGTSVQNMLHWSQAVKFQKFQAFDWGSSAKNYFHYN QSYPPTYNVKDMLVPTAVWSGGHDWLADVYDVNILLTQITNLVFHESIPE WEHLDFIWGLDAPWRLYNKIINLMRKYQ


    Database link: P38571

  • Positive control

    • WB: A431 whole cell lysate. IHC-P: Human small intestine and colon cancer tissues. ICC/IF: HepG2 cells.
  • General notes

     This product was previously labelled as Lysosomal acid lipase

     

Properties

Applications

Our Abpromise guarantee covers the use of ab236736 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.
IHC-P 1/20 - 1/200.
WB 1/1000 - 1/5000. Predicted molecular weight: 45 kDa.

Target

  • Function

    Crucial for the intracellular hydrolysis of cholesteryl esters and triglycerides that have been internalized via receptor-mediated endocytosis of lipoprotein particles. Important in mediating the effect of LDL (low density lipoprotein) uptake on suppression of hydroxymethylglutaryl-CoA reductase and activation of endogenous cellular cholesteryl ester formation.
  • Involvement in disease

    Defects in LIPA are the cause of Wolman disease (WOD) [MIM:278000]. WOD is a severe manifestation of LIPA deficiency, leading to the accumulation of cholesteryl esters and triglycerides in most tissues of the body. WOD occurs in infancy and is nearly always fatal before the age of 1 year.
    Defects in LIPA are the cause of cholesteryl ester storage disease (CESD) [MIM:278000]. CESD is a mild manifestation of LIPA deficiency, leading to the accumulation of cholesteryl esters and triglycerides in most tissues of the body. It is characterized by late-onset.
  • Sequence similarities

    Belongs to the AB hydrolase superfamily. Lipase family.
  • Cellular localization

    Lysosome.
  • Information by UniProt
  • Database links

    • Alternative names

      • Acid cholesteryl ester hydrolase antibody
      • CESD antibody
      • cholesterol ester hydrolase antibody
      • cholesterol ester storage disease antibody
      • Cholesteryl esterase antibody
      • Hydrolase deficiency antibody
      • LAL antibody
      • LAL deficiency cholesterol ester antibody
      • LICH_HUMAN antibody
      • lipA antibody
      • LIPA deficiency antibody
      • Lipase A antibody
      • lipase A, lysosomal acid, cholesterol esterase antibody
      • lysosomal acid lipase antibody
      • lysosomal acid lipase deficiency antibody
      • Lysosomal acid lipase/cholesteryl ester hydrolase antibody
      • Sterol esterase antibody
      see all

    Images

    • Anti-Lysosomal acid lipase/LAL antibody (ab236736) at 1/1000 dilution + A431 (human epidermoid carcinoma cell line) whole cell lysate

      Secondary
      Goat polyclonal to rabbit IgG at 1/10000 dilution

      Predicted band size: 45 kDa

    • Paraffin-embedded human small intestine tissue stained for Lysosomal acid lipase/LAL using ab236736 at 1/100 dilution in immunohistochemical analysis.

    • Paraffin-embedded human colon cancer tissue stained for Lysosomal acid lipase/LAL using ab236736 at 1/100 dilution in immunohistochemical analysis.

    • HepG2 (human liver hepatocellular carcinoma cell line) cells stained for Lysosomal acid lipase/LAL (green) using ab236736 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).

    References

    ab236736 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    There are currently no Customer reviews or Questions for ab236736.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Sign up