Overview

  • Product name

  • Description

    Rabbit polyclonal to LYST
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant fragment corresponding to Human LYST aa 2848-2948.
    Sequence:

    KKYETEEGVNKAAWQKTVNNNQQSLFQRLDSKSKDISKIAADITQAVSLS QGNERKKVIQHIRGMYKVDLSASRHWQELIQQLTHDRAVWYDPIYYPTSW Q


    Database link: Q99698

  • Positive control

    • A431 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab220481 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    May be required for sorting endosomal resident proteins into late multivesicular endosomes by a mechanism involving microtubules.
  • Tissue specificity

    Abundantly expressed in adult and fetal thymus, peripheral blood leukocytes, bone marrow and several regions of the adult brain.
  • Involvement in disease

    Defects in LYST are the cause of Chediak-Higashi syndrome (CHS) [MIM:214500]. CHS is a rare autosomal recessive disorder characterized by hypopigmentation, severe immunologic deficiency, a bleeding tendency, neurologic abnormalities, abnormal intracellular transport to and from the lysosome, and giant inclusion bodies in a variety of cell types. Most patients die at an early age unless they receive an allogeneic hematopoietic stem cell transplant (SCT).
  • Sequence similarities

    Contains 1 BEACH domain.
    Contains 7 WD repeats.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • Beige homolog antibody
    • beige protein antibody
    • Chediak-Higashi syndrome 1 antibody
    • CHS antibody
    • CHS1 antibody
    • Lysosomal-trafficking regulator antibody
    • LYST antibody
    • LYST_HUMAN antibody
    • OTTHUMP00000038327 antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized A431 cells labeling LYST with ab220481 at 4 μg/ml (green).

References

ab220481 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220481.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up