Overview

  • Product name

  • Description

    Rabbit polyclonal to LZTFL1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IP, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Cynomolgus monkey, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human LZTFL1 aa 116-299.
    Sequence:

    EFEKAEITSSNKKPILDVTKPKLAPLNEGGTAELLNKEILRLQEENEKLK SRLKTIEIQATNALDEKSKLEKALQDLQLDQGNQKDFIKAQDLSNLENTV AALKSEFQKTLNDKTENQKSLEENLATAKHDLLRVQEQLHMAEKELEKKF QQTAAYRNMKEILTKKNDQIKDLRKRLAQYEPED


    Database link: Q9NQ48

  • Positive control

    • WB: HEK-293T, HepG2, HeLa and U-251 MG whole cell lysates. IHC-P: Human testis tissue. ICC/IF: U-251 MG cells. IP: HepG2 whole cell lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab236795 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Predicted molecular weight: 35 kDa.
IP 1/200 - 1/2000.
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

  • Information by UniProt
  • Database links

  • Alternative names

    • 5530402H04Rik antibody
    • 6130400H19Rik antibody
    • AI414725 antibody
    • AW048545 antibody
    • BBS17 antibody
    • DKFZp686H2076 antibody
    • FLJ36386 antibody
    • Leucine zipper transcription factor like 1 antibody
    • Leucine zipper transcription factor like protein 1 antibody
    • Leucine zipper transcription factor-like protein 1 antibody
    • LZTFL 1 antibody
    • Lztfl1 antibody
    • Lztfl1 leucine zipper transcription factor-like 1 antibody
    • LZTL1_HUMAN antibody
    • MGC106871 antibody
    • MGC108960 antibody
    • Putative uncharacterized protein DKFZp686H2076 antibody
    see all

Images

  • All lanes : Anti-LZTFL1 antibody (ab236795) at 1/500 dilution

    Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate
    Lane 2 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate
    Lane 3 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 4 : U-251 MG (human brain glioma cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 35 kDa

  • Paraffin-embedded human testicular tissue stained for LZTFL1 using ab236795 at 1/100 dilution in immunohistochemical analysis.

  • U-251 MG (human brain glioma cell line) cells stained for LZTFL1 (green) using ab236795 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).

  • LZTFL1 was immunoprecipitated from HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate with ab236795 at 1/200 dilution. 

    Lane 1: Rabbit control IgG IP in HepG2 whole cell lysate.

    Lane 2: ab236795 IP in HepG2 whole cell extract.

    Lane 3: HepG2 whole cell lysate  (20 μg) Input.

    For western blotting, a HRP-conjugated light chain specific antibody was used as the Secondary antibody at 1/50000 dilution.

References

ab236795 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236795.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up