Overview

  • Product name

  • Description

    Rabbit polyclonal to M-CSF
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human M-CSF aa 33-554.
    Sequence:

    EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYL KKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDK ACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQD VVTKPDCNCLYPKAIPSSDPASVSPHQPLAPSMAPVAGLTWEDSEGTEGS SLLPGEQPLHTVDPGSAKQRPPRSTCQSFEPPETPVVKDSTIGGSPQPRP SVGAFNPGMEDILDSAMGTNWVPEEASGEASEIPVPQGTELSPSRPGGGS MQTEPARPSNFLSASSPLPASAKGQQPADVTGTALPRVGPVRPTGQDWNH TPQKTDHPSALLRDPPEPGSPRISSLRPQGLSNPSTLSAQPQLSRSHSSG SVLPLGELEGRRSTRDRRSPAEPEGGPASEGAARPLPRFNSVPLTDTGHE RQSEGSFSPQLQESVFHLLVPSVILVLLAVGGLLFYRWRRRSHQEPQRAD SPLEQPEGSPLTQDDRQVELPV


    Database link: P09603

  • Positive control

    • IHC-P: Human tonsil tissue. ICC/IF: A549 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab236247 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.
IHC-P 1/20 - 1/200.

Target

  • Function

    Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. CSF-1 induces cells of the monocyte/macrophage lineage. It plays a role in immunological defenses, bone metabolism, lipoproteins clearance, fertility and pregnancy.
  • Post-translational
    modifications

    Glycosylation and proteolytic cleavage yield different soluble forms. A high molecular weight soluble form is a proteoglycan containing chondroitin sulfate.
    Isoform 1 is N- and O-glycosylated. Isoform 3 is N-glycosylated.
  • Cellular localization

    Cell membrane and Secreted > extracellular space.
  • Information by UniProt
  • Database links

  • Alternative names

    • Colony stimulating factor 1 (macrophage) antibody
    • Colony stimulating factor 1 antibody
    • Colony stimulating factor macrophage specific antibody
    • CSF 1 antibody
    • CSF-1 antibody
    • CSF1 antibody
    • CSF1_HUMAN antibody
    • Csfm antibody
    • Lanimostim antibody
    • M CSF antibody
    • M-CSF antibody
    • Macrophage Colony Stimulating Factor 1 antibody
    • Macrophage colony stimulating factor antibody
    • MCSF antibody
    • MGC31930 antibody
    • Processed macrophage colony-stimulating factor 1 antibody
    see all

Images

  • Paraffin-embedded human tonsil tissue stained for M-CSF using ab236247 at 1/100 dilution in immunohistochemical analysis.

  • A549 (human lung carcinoma cell line) cells stained for M-CSF (green) using ab236247 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).

References

ab236247 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236247.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up