Overview

  • Product name

  • Description

    Rabbit polyclonal to MA2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Rat MA2 aa 74-333. Expressed in E. coli. N-terminal tags.
    Sequence:

    DMSVVPSEVQGKGGVWKVIFKTPNQDTEFLQRLNLFLEKEGQTVAGMFRA LKHEGVSPATTPCTSPELLAHLVGQAMVHAQRPLLPVRYCKLRVFSGSTV AAPEEEPFEVWLEQATEIAKEWPIPETEKKRWVTESLRGPALDLMHIVQA DNPSISAEECLEAFKQVFGSMESRRTSQVKYLKTYQQEGEKISAYVLRLE TLLRRAVEKRAIPRNIADQVRLEQVMAGANLSNVLWCRLRELKDQGPLPT FLQLMKVVRE


    Database link: D4A068

  • Positive control

    • WB: Recombinant rat MA2 protein; Rat brain tissue lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab232825 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 41 kDa.

Target

  • Tissue specificity

    Brain specific. In some patients suffering from cancers, it is also specifically expressed by the testicular tumor cells.
  • Sequence similarities

    Belongs to the PNMA family.
  • Cellular localization

    Nucleus > nucleolus.
  • Information by UniProt
  • Database links

  • Alternative names

    • 40 kDa neuronal protein antibody
    • KIAA0883 antibody
    • MA2 antibody
    • MM2 antibody
    • Onconeuronal antigen Ma2 antibody
    • Paraneoplastic antigen Ma2 antibody
    • Paraneoplastic Ma antigen 2 antibody
    • Paraneoplastic neuronal antigen antibody
    • Paraneoplastic neuronal antigen MM2 antibody
    • PNMA2 antibody
    • PNMA2_HUMAN antibody
    • Retrotransposon gag domain containing 2 antibody
    • RGAG2 antibody
    see all

Images

  • Anti-MA2 antibody (ab232825) at 2 µg/ml + Rat brain tissue lysate

    Secondary
    HRP-linked Guinea pig anti-Rabbit at 1/2000 dilution

    Predicted band size: 41 kDa

  • Anti-MA2 antibody (ab232825) at 2 µg/ml + Recombinant rat MA2 protein

    Predicted band size: 41 kDa

References

ab232825 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232825.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up